(data stored in ACNUC9435 zone)

EMBL: CP000904.PE230

CP000904.PE230       Location/Qualifiers
FT   CDS_pept        complement(338481..338846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5694"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5694"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46654"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT3"
FT                   /protein_id="ABY46654.1"
FT                   /translation="MVKKACVSIITGILLICSTGCATQTDSITAKTQSIDDGTYTTKEI
FT                   TDAFPVGTPITTYIRKEEKLNVKHLTSITLTDGGVGRVLEATDGFVVVCGNEKGVFDVL
FT                   IFKTLEDVKKYEQSLAR"
     atggtaaaaa aagcttgtgt aagtattatt actggaattc ttttaatatg ttcaacagga        60
     tgtgccactc aaactgattc tattacagct aaaactcaat caatagatga tggcacatat       120
     acaacaaaag agatcacaga cgcatttcct gtaggaacac ccataactac ttacattcga       180
     aaagaagaaa aactaaacgt aaaacatctc accagtatta cacttacaga tggtggcgtc       240
     ggtagagttt tggaagcgac agatggtttt gttgtcgtat gtgggaatga aaaaggagtt       300
     tttgatgtgt taatatttaa aactttggaa gatgtaaaga aatatgaaca gagtttagcg       360
     cgataa                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page