(data stored in ACNUC9435 zone)

EMBL: CP000904.PE231

CP000904.PE231       Location/Qualifiers
FT   CDS_pept        339720..340145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5695"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mul:MUL_1266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5695"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46655"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT4"
FT                   /protein_id="ABY46655.1"
FT                   /translation="MLPDYIKIAHEIAKKAHVGQVDKAGMDYIKHPETVASFVNTTEEK
FT                   ATAYLHDVLEDTEITAADLLNAGIPYNVVEAVQVLTKEKYTPYFEYLSKVKENSLARTV
FT                   KLADLKHNSDRSRLARITDKDLKRLEKYRTAIKFLGE"
     atgttaccag attatataaa gatagctcat gagatagcta aaaaagccca tgttggacaa        60
     gtagataaag caggaatgga ctatatcaaa caccctgaga cagttgctag ctttgtaaat       120
     acgaccgaag agaaagctac tgcttatttg catgatgttc ttgaagatac tgagataaca       180
     gctgctgatt tattaaatgc tggtatacct tataacgtag tggaggcagt gcaggtacta       240
     acaaaagaga aatacacgcc ttattttgag tatctgagca aagtgaaaga aaattctctt       300
     gcccgtactg tcaaacttgc agacttaaaa cataattctg accgctcacg acttgctaga       360
     ataacagata aagacctaaa acgattggag aagtatcgca cagcgattaa gtttttaggg       420
     gaataa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page