(data stored in ACNUC9435 zone)

EMBL: CP000904.PE233

CP000904.PE233       Location/Qualifiers
FT   CDS_pept        340539..340832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5697"
FT                   /product="group-specific protein"
FT                   /note="KEGG: bcz:BCZK2933 group-specific protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5697"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46657"
FT                   /db_xref="GOA:A9VUT6"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT6"
FT                   /protein_id="ABY46657.1"
FT                   /translation="MEFIKYAVIIIIVLSCLSELYMFKFQKSQEARDERGLDIQYKTTN
FT                   FLYNTLYLGIVILFLLNILQYITAEQFVNILLYFFISLGIIKVAYSYWRRSY"
     atggaattta taaagtatgc tgtaattatt attatagttt tatcatgctt aagtgaatta        60
     tatatgttta aatttcaaaa aagccaagag gcaagagatg agagaggttt agatattcaa       120
     tataaaacta ctaatttttt atataatact ctttatctgg gaatagttat attatttctc       180
     cttaacatac ttcaatatat tacagcagaa caatttgtga atatcctctt atatttcttt       240
     atttctttag ggataataaa agttgcttat tcatattgga gaaggagcta ttaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page