(data stored in ACNUC9435 zone)

EMBL: CP000904.PE234

CP000904.PE234       Location/Qualifiers
FT   CDS_pept        complement(341333..342007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5699"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5699"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46658"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT7"
FT                   /protein_id="ABY46658.1"
FT                   /translation="MKQVLRKSKRKMIYLVGSLLIALSMFATTSFAATEGAVKSVTNSN
FT                   YTGIAADINLPKSVVVKDGYVNWYLGIGASKVEGGISKTSSGYKVFLNSGYNESGQNSK
FT                   YWNTQYDTSIKDGDRVNLKLVNNGNGTVTMYVNGSPKYVNQPVYGTFSQYEPVKMVQGV
FT                   EDTGSNSFSQASFSNVLLRADTSGSTYKSWNSSISSSFSQHGTYGSNFKVYSQVPLSAS
FT                   LR"
     atgaaacaag tattaaggaa aagtaagaga aaaatgatat atctagttgg ttcacttcta        60
     attgctctat caatgtttgc aactacaagt tttgcagcta cagaaggtgc tgtaaaaagt       120
     gttacaaata gtaactatac cgggattgca gctgatataa atctaccaaa atcagttgtt       180
     gttaaggatg gatatgtgaa ttggtattta ggtattggag catctaaagt tgagggtggt       240
     atttcaaaaa catcaagtgg atataaagta tttcttaatt caggatataa tgaatcaggt       300
     caaaacagta agtattggaa cacacagtat gatacatcaa ttaaagatgg tgatcgagta       360
     aaccttaaac tagttaataa cggaaatggt acggttacta tgtatgtaaa tggaagtcct       420
     aaatatgtaa atcaacctgt atatggtacg ttttctcaat atgaaccagt aaaaatggtt       480
     cagggcgttg aagatactgg aagtaattct tttagccaag ctagcttttc aaacgtactt       540
     ctaagagcag atacatctgg atctacctac aaaagttgga acagctcaat ttcttcctca       600
     ttttctcaac acggtactta tggtagtaat ttcaaagttt attctcaagt accattaagc       660
     gcaagtttac gttaa                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page