(data stored in ACNUC9435 zone)

EMBL: CP000904.PE237

CP000904.PE237       Location/Qualifiers
FT   CDS_pept        344999..345598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5702"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5702"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46661"
FT                   /db_xref="GOA:A9VUU0"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU0"
FT                   /protein_id="ABY46661.1"
FT                   /translation="MKGEENLKMLNSVAPKQIKNEDLPFDISWMTDWIVDWFGSLFNGG
FT                   SDVIKDGGNKVDGVVHASVPAFFDVIFLILSVVILISLLVFGASLWFKHIKWKKRSIYF
FT                   GVGSFILILLIRILPVLMLTTRSFDFQTFMSNMVGLITSIILGTAVLMFLISLALGMLY
FT                   KKFEHPKYGKWSSSLRYSSIFIFVMTLIVPALLRHL"
     atgaaggggg aggagaattt gaaaatgctc aattcagttg ctcctaaaca aataaaaaat        60
     gaagatttac catttgatat ttcctggatg accgattgga ttgtagactg gtttggttct       120
     ttgtttaatg gcggcagtga tgtaataaaa gatgggggaa ataaagtaga tggtgtagtc       180
     catgcgagtg tgcctgcatt ttttgatgtg attttcctta ttctttctgt agtaatttta       240
     atttcattat tagtttttgg agcctcttta tggtttaaac atataaagtg gaaaaaaaga       300
     tctatatatt ttggagtagg ttcgtttatt ctcattctat taataaggat tctaccagtg       360
     ttaatgttga caacacgttc ttttgatttt caaaccttta tgagtaatat ggtgggctta       420
     attacttcta taattttagg gacagctgta ttaatgtttt taatatcgct agcattaggt       480
     atgctttata agaaatttga acatcccaaa tatggaaaat ggagttcaag tttgagatat       540
     agttcaattt ttatatttgt aatgacattg atagtaccgg ccttgctgcg tcatttataa       600
//

If you have problems or comments...

PBIL Back to PBIL home page