(data stored in ACNUC9435 zone)

EMBL: CP000904.PE239

CP000904.PE239       Location/Qualifiers
FT   CDS_pept        complement(347907..348281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5707"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bat:BAS3055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5707"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46663"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU2"
FT                   /protein_id="ABY46663.1"
FT                   /translation="MQGNQIRKNAARTVIHNDINNYPYLNIPMIINEKDGIIYEVLSAG
FT                   FHNNDAVAMITTDGFTTTRVNTPIVTVKNDDSSIQVFRLPLELDYWVLSCMRAASTGKN
FT                   PFPCKVAFGIIDTKCHVEFK"
     atgcaaggga atcagatacg aaagaacgca gcaagaacag ttattcataa tgatataaat        60
     aactatccct atttaaatat acctatgatt atcaatgaga aggatggaat aatttacgag       120
     gttttaagcg ctggttttca taataatgat gcagtagcaa tgataacaac tgacggtttt       180
     actacaacta gggtaaatac accaatcgta acagtaaaaa acgatgatag tagtatccaa       240
     gtattccgtt tacctttaga attggattat tgggtacttt catgtatgcg tgctgcttca       300
     acaggaaaaa atccgttccc atgtaaagtt gcttttggaa tcattgatac taaatgtcat       360
     gtggaattca agtga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page