(data stored in ACNUC9435 zone)

EMBL: CP000904.PE24

CP000904.PE24        Location/Qualifiers
FT   CDS_pept        46828..47514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5457"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bca:BCE_2757 ABC transporter domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5457"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46448"
FT                   /db_xref="GOA:A9VV16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV16"
FT                   /protein_id="ABY46448.1"
FT                   /translation="METILQFKNLDYYYESNGKKVTILDNVNFSFQKGHFYTILGPSGS
FT                   GKTTTLSLGCGLDIPKNGYVLFNGKDIRKIGLDRYRNQNVSVIFQSYNLITYMTALQNV
FT                   LTAMEITGVKVQNKKARALELLEKVGLTEVEAKRNVLQLSGGQQQRVAIARALSCNVDL
FT                   LIADEPTGNLDGETAKEIIELFQELAHQENKCVIVVTHSQEVAKKSDRAVYLSKKKLVV
FT                   NEINNS"
     atggagacga ttttacaatt taaaaactta gattattact atgaaagtaa cggaaaaaaa        60
     gtaacgatac tagataatgt taatttttct tttcaaaaag ggcatttcta cacgatttta       120
     gggccatctg gatctggtaa aaccacaact cttagcttag gttgtgggct agatatacct       180
     aaaaatggtt atgtactatt taatggaaag gatattcgga aaattggctt ggatcgatac       240
     cgtaatcaaa atgtatccgt aattttccaa tcctataatt tgattaccta tatgactgct       300
     cttcagaatg tactaacggc aatggaaatt acaggtgtga aggtacaaaa taaaaaagca       360
     agagcattag aattattaga gaaggtagga ctcacagaag tagaagcgaa acgaaatgtc       420
     ttgcaactaa gtggcgggca acaacagcgt gtagcaattg ctagggcact atcttgcaat       480
     gttgatttac ttattgcgga tgaaccaaca ggaaaccttg atggagaaac agcaaaagag       540
     attattgagt tgtttcaaga gcttgctcat caagagaata aatgtgtaat tgttgttacg       600
     cattcacaag aagttgcaaa aaaatcggat cgagcagtgt atttaagtaa aaagaagtta       660
     gtagtaaacg aaattaataa tagctaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page