(data stored in ACNUC9435 zone)

EMBL: CP000904.PE240

CP000904.PE240       Location/Qualifiers
FT   CDS_pept        complement(348324..348644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5708"
FT                   /product="YolD-like protein"
FT                   /note="PFAM: YolD-like protein; KEGG: bat:BAS3054
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5708"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46664"
FT                   /db_xref="InterPro:IPR014962"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU3"
FT                   /protein_id="ABY46664.1"
FT                   /translation="MNNANMQQGRGMVKWARFAGIREMIKEKNKVASPILTSEEKELIK
FT                   NMLLCSLLSEEEILITYYEGGYLLTNYMTIIDIDSLNNAIICTDAFYNKLTLQFSDILD
FT                   VK"
     atgaacaacg ctaatatgca acaaggccga ggaatggtaa aatgggcgcg attcgccgga        60
     attcgtgaaa tgattaaaga gaaaaataaa gtagcatctc ctattttaac ctctgaagaa       120
     aaagaactga ttaagaacat gcttttatgt tccttattgt ccgaagaaga aatactaatt       180
     acatattatg aaggcggcta tttacttact aactatatga ccatcatcga tatagattcg       240
     ctaaataacg ctatcatatg tacggatgct ttttataata agttgacact acaattttcg       300
     gatatactgg atgtaaaata g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page