(data stored in ACNUC9435 zone)

EMBL: CP000904.PE241

CP000904.PE241       Location/Qualifiers
FT   CDS_pept        complement(349990..351117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5710"
FT                   /product="replication initiator A domain protein"
FT                   /note="PFAM: replication initiator A domain protein; KEGG:
FT                   ssp:SSPP204 replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5710"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46665"
FT                   /db_xref="InterPro:IPR010724"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU4"
FT                   /protein_id="ABY46665.1"
FT                   /translation="MLKKRINIKDIPNEEFYKLPKVFIWKKQYRENLSIGAKLLYMLIR
FT                   DRFNLSIYTTQISVDNGNDTPAFVDEKGDIYCILDNQEIEFSLNISNKTVTKFMEELIA
FT                   EELVSTESVDGGANRIYLNEPDPSGASLAHFLGEKEFYKHVKMRKKKKKEPLKTLEECI
FT                   ATAIDKYGVKKVDKKNSITREGKIPVPSDGKSTPLSEEKTPPLGEEKVHPNNIYSSYLD
FT                   LSEIYPNENDTNPNKSSKSKIDEEPIEELKNNIVLQKNNYALLNPILEQVGICPDLKAL
FT                   NVVKKILAEAGITTFHKVDVLNAIGKHAMNVKKYLSQGEVIEYEPAFFANNLVDRIREN
FT                   TLKRQNEVKKLKKIENQQTHETTFHFSSYNWLEVN"
     atgttaaaaa agagaattaa tataaaagat ataccaaacg aagagttcta caaactacct        60
     aaagttttca tttggaaaaa acaatatcgt gagaatttaa gtatcggtgc gaaattacta       120
     tacatgttaa taagagatcg atttaattta tctatatata caacacaaat ttcagttgat       180
     aacggaaacg acacgcctgc cttcgtagat gaaaaaggtg atatttattg tattttagat       240
     aatcaagaaa tcgaattctc attaaatatt tcaaacaaaa ctgttacgaa gtttatggaa       300
     gagcttatag ctgaagaact tgtatccaca gaatcagtag atggaggcgc taatcgaatc       360
     tacttgaatg aacccgatcc tagtggagcg tcattagcac atttcctagg tgagaaagaa       420
     ttctacaaac atgttaagat gcgtaagaaa aagaagaaag aaccattaaa aacattagaa       480
     gagtgtatag ctacagctat agataaatac ggtgtaaaaa aagtagataa gaaaaattcc       540
     attactaggg aaggaaaaat tccggtacct agtgatggaa aaagtacacc ccttagtgag       600
     gagaaaactc cacccctagg ggaggaaaaa gtacatccta ataatattta ttctagttat       660
     cttgacctta gtgagattta tcccaacgag aatgatacaa acccaaataa atcttctaaa       720
     tcaaaaatag atgaagaacc aatagaagaa cttaaaaata atattgtttt acaaaaaaat       780
     aattatgcct tattaaatcc tatccttgaa caagttggga tttgtcccga tctaaaggca       840
     cttaacgttg tgaagaaaat acttgcagaa gctggaatta caacattcca caaggtagat       900
     gtattaaatg caataggtaa acatgctatg aacgtcaaaa agtatttatc ccaaggcgaa       960
     gtaattgaat acgaacctgc atttttcgct aataatcttg tagaccgtat tagagagaat      1020
     actcttaagc gtcaaaacga agtgaaaaaa ctgaaaaaga tagaaaacca acaaacccat      1080
     gaaaccactt ttcatttttc ttcttacaat tggcttgaag taaattaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page