(data stored in ACNUC9435 zone)

EMBL: CP000904.PE242

CP000904.PE242       Location/Qualifiers
FT   CDS_pept        351803..352237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5711"
FT                   /product="arsenate reductase and related"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   sae:NWMN_0867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5711"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46666"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU5"
FT                   /protein_id="ABY46666.1"
FT                   /translation="MKSLNITIYTINSAEGERVAEKLAKYDLMVTNKHIVRDRFTFTEF
FT                   KALLALTDNGLDDLLTQRGSTIDFLTEQGIDLDDLTLREAYNVILQNPKLLKTTILTDW
FT                   NRIAFGLNGTKMFLPRHLRKQEQRKMYLKPEAQIEYEEAS"
     ttgaaaagcc ttaatattac tatttataca attaacagtg cagaaggaga aagggttgca        60
     gaaaaattag ccaagtacga tttaatggtg acaaataaac atattgtacg agatcgtttt       120
     acttttactg agttcaaagc tttgttagcg ttaacagaca acggtttaga tgacttatta       180
     actcaacgtg gtagtacaat tgattttctt actgaacaag ggattgatct tgatgactta       240
     acgttacgtg aagcatacaa tgtcattctt caaaatccga agttgctaaa aacaactatc       300
     ttgacagact ggaacaggat tgcatttggg ctaaacggta cgaagatgtt ccttccacga       360
     catttaagaa agcaagaaca acggaagatg tacttaaaac cagaagcaca aatcgagtac       420
     gaggaagcta gttga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page