(data stored in ACNUC9435 zone)

EMBL: CP000904.PE244

CP000904.PE244       Location/Qualifiers
FT   CDS_pept        353634..353873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5713"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46668"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU7"
FT                   /protein_id="ABY46668.1"
FT                   /translation="MNRLATEELGPVEGSVLDAVPDVVVPHVSGFLVRGIIHCITLKTK
FT                   EDFLNTNKHLLTRVDFHIFEIADSERYINRVTNN"
     atgaacagat tggcaacaga agaattagga ccggtagaag gtagtgttct ggatgcagta        60
     ccagatgtag ttgttcctca cgtatctggt tttctagtta gaggaattat acattgcatt       120
     acattaaaaa caaaagaaga tttcttaaac actaataaac acctcttaac tagagtggat       180
     tttcatattt ttgaaattgc agatagcgaa cgctatataa atcgagtaac aaataactaa       240
//

If you have problems or comments...

PBIL Back to PBIL home page