(data stored in ACNUC9435 zone)

EMBL: CP000904.PE245

CP000904.PE245       Location/Qualifiers
FT   CDS_pept        353906..354700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5714"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF10_0351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5714"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46669"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU8"
FT                   /protein_id="ABY46669.1"
FT                   /translation="MQKTLAKEYIESVAKALLETSPREVIEFKTVLNAHPQGNETHAGI
FT                   NEVISRIFTDPLLTELLSIVGIESEEKTVQEPILASLLASQISTQQLSKQIREQVAKVD
FT                   MDSSVMIPYMKLEPKANLAAFIKEQAAFNKLVEDIKAQFEVNTKEDFAANIKDQVEQQR
FT                   PAKTTEGKIKSILDEVVNEIIEDGAASQTVCLDPSGIKVYEILFSSVFYKKANMLGFKE
FT                   SVEYKHEYTAYILSELATYLVEEEGFKLSFEVVEDKVVAGLA"
     atgcaaaaaa cattagctaa agaatacatt gaatctgtag caaaggcttt attagaaaca        60
     tctccaagag aggtaataga atttaaaaca gtattaaatg cacacccaca aggtaatgaa       120
     actcatgcag ggattaacga agtaatttct cgtattttca ctgatccatt attgacagaa       180
     ctcttatcta ttgtaggaat tgaatctgaa gagaaaacag tacaagaacc aattcttgct       240
     agcttattag cttctcaaat ttcaactcaa caactttcta aacaaattcg tgaacaagta       300
     gcgaaagtag atatggattc ttcagtaatg attccttaca tgaaattaga accaaaggct       360
     aatcttgcag cttttatcaa ggaacaagct gctttcaata aacttgtaga agacataaag       420
     gctcaattcg aagtgaatac caaagaagat tttgctgcaa atattaaaga tcaagtagaa       480
     caacaaagac ctgctaagac tactgaggga aaaataaaaa gtatccttga tgaagttgtt       540
     aacgaaatca ttgaagacgg agctgctagt caaacagttt gcttagaccc tagtggaatt       600
     aaggtttacg aaattctatt ttcttctgtt ttctataaaa aggcaaatat gttaggtttt       660
     aaagagtctg tagagtacaa gcacgaatac acagcatata tcctaagtga acttgctact       720
     tatttagttg aagaagaagg ctttaaacta tcctttgagg tggtagaaga taaggtagta       780
     gcaggtttag cttaa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page