(data stored in ACNUC9435 zone)

EMBL: CP000904.PE246

CP000904.PE246       Location/Qualifiers
FT   CDS_pept        354924..355910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5715"
FT                   /product="N-acetylmuramoyl-L-alanine amidase"
FT                   /EC_number="3.5.1.28"
FT                   /note="KEGG: bat:BAS3490 prophage LambdaBa01,
FT                   N-acetylmuramoyl-L-alanine amidase, family 2; PFAM:
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SH3 type 3
FT                   domain protein; SMART: SH3 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5715"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46670"
FT                   /db_xref="GOA:A9VUU9"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUU9"
FT                   /protein_id="ABY46670.1"
FT                   /translation="MAIPVIQNLVAASKYPIKAPYSMNAEYITVHNTYNDAPAKNEINY
FT                   MVGNNNEVSFHFAVDDIEVIQGIPVNRNAWHCGDGSGNGNRKSIGVEICYSLSGGPRYE
FT                   KAESLAIKFVAQLLRERGWGIDRVRTHKSWTEIGVRNGNSRAVKNCPHRILDEGRWNSF
FT                   LAAVQAELTGTGATIAPPVTQPPSSDGIGVVEILVPELNVREFASFDSRVVKTVKKGEM
FT                   YQTWGLSNGLYNVGGNQWVSAGPAYVKFTPAGSSNGNPENLAGKRDPIGKITTTANLNV
FT                   RTQSSTDGDIIRTIPNGETWNIYDISGGWARVHDGWVSLAYANLTRY"
     atggccattc cagttataca aaatcttgtg gctgcaagta aatatccaat caaagctcct        60
     tattctatga acgcagagta tattacagtg cataatacgt ataatgatgc tcctgcaaaa       120
     aacgaaataa attacatggt tggaaataac aatgaggttt catttcattt tgcagtagat       180
     gatattgaag ttattcaggg tattccagtt aatcgtaatg cttggcattg tggagatggc       240
     agtgggaatg gaaaccgaaa atctatcggt gttgaaatct gttactcgtt gtctggtggt       300
     ccaagatacg aaaaagctga aagtttagca attaaattcg tcgctcaact gttacgagaa       360
     cgcggatggg gaattgatcg tgtgcgtact cataagagtt ggacagagat tggtgttcga       420
     aacggtaatt ctagagcagt taagaattgc ccacaccgta tcttagatga agggcgctgg       480
     aatagtttct tagcagcagt acaagctgaa cttactggta cgggtgcaac tatagcacca       540
     ccagtaactc aacccccatc ttcagatggt attggtgttg ttgagattct tgttccagaa       600
     cttaatgtaa gggaatttgc tagctttgat tcacgagttg ttaagacagt gaaaaaaggt       660
     gaaatgtatc aaacttgggg actatctaat ggtctataca atgttggagg aaaccagtgg       720
     gtgtcagcag gtcctgctta tgttaagttt actcctgcag gaagttctaa tggaaatcca       780
     gaaaatctag cgggaaaacg tgatccaatt gggaaaatta caactactgc aaatctaaac       840
     gttcgtacac aatcttctac agatggggat attattcgta ctatccctaa tggagaaacg       900
     tggaatatct acgatattag tggtggatgg gcgagagtgc atgatggttg ggtttctcta       960
     gcttatgcaa atctaacaag atattaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page