(data stored in ACNUC9435 zone)

EMBL: CP000904.PE247

CP000904.PE247       Location/Qualifiers
FT   CDS_pept        357113..357484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5716"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: amt:Amet_0033 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5716"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46671"
FT                   /db_xref="GOA:A9VUV0"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV0"
FT                   /protein_id="ABY46671.1"
FT                   /translation="MHQIITITGRLTRDPESNTYGEKTVCRFAVAVDDGYGDKKTTDFF
FT                   NVSVWGKMGEKVQRYQKKGSVVQVIGKMKSSKKDKTTYWELRANNIVFFTFDNNSNQQQ
FT                   NNFEMFTDDINISDDDLPF"
     atgcatcaaa ttattacaat tacaggtcgc ttaactcgtg atcctgagag taatacgtat        60
     ggtgaaaaga cagtttgtcg ttttgctgta gcagtagatg atgggtatgg agataaaaaa       120
     actactgatt tctttaatgt atctgtttgg gggaaaatgg gtgaaaaagt acaaagatac       180
     caaaagaaag gttctgttgt gcaagtaatc ggtaaaatga aatcttctaa gaaggataaa       240
     actacgtact gggaattacg cgcaaataac attgtatttt ttacctttga taataatagt       300
     aatcaacaac aaaataactt tgaaatgttc actgatgaca taaatatcag tgatgatgat       360
     ttaccatttt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page