(data stored in ACNUC9435 zone)

EMBL: CP000904.PE248

CP000904.PE248       Location/Qualifiers
FT   CDS_pept        357515..357847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5717"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5717"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46672"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV1"
FT                   /protein_id="ABY46672.1"
FT                   /translation="MSDQRRLRSELKQGLHQFTMTLYNSYRQTLSHEKSVEQLSNCLIE
FT                   EYEYLTKQVMKQEKTFNLGSLVEKVEKRAKDEKDPVKQFELYEDVEILLRAQELVTKYE
FT                   TGKDNK"
     atgagtgatc agagaaggtt acggtcggag ttaaaacaag ggctccatca atttacgatg        60
     accctttata attcttatag acaaacttta tcgcatgaaa aatctgtaga acaattatcc       120
     aactgtttaa tagaagagta tgaatattta actaaacaag ttatgaaaca agaaaaaact       180
     tttaatcttg gaagccttgt tgaaaaggtg gaaaaacgtg ctaaggatga aaaggacccc       240
     gtaaaacagt ttgagttgta tgaagatgtg gaaattctat tgcgtgcaca ggaacttgtt       300
     acaaaatacg aaacggggaa ggataataaa tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page