(data stored in ACNUC9435 zone)

EMBL: CP000904.PE250

CP000904.PE250       Location/Qualifiers
FT   CDS_pept        360366..361085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5720"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46674"
FT                   /db_xref="GOA:A9VUV3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV3"
FT                   /protein_id="ABY46674.1"
FT                   /translation="MNSANLGWFVLSQTILGIGSYAIMCAIFCLRFHRNITMISLLSFL
FT                   TSIINYSIYFNKQEGIGYLVPIIGMLITFLYLAAIEKLSIMWALVVTVAGGVIIPLIIQ
FT                   IMIIFASLGFFSPSELKEHIWRNYAMDITSGFSYALLAFVLYSQEWTFKFDFEKIRFKY
FT                   EKYIVIGISLVAAIVLPASMFMTHVKGTDLNLIFLTISSTLVFILLLIFSIRKERTEKQ
FT                   FDKTIKEVKTNAQKNDV"
     ttgaattcag caaacttggg ttggtttgtt ttatctcaaa caattttggg aattggcagt        60
     tatgcaatta tgtgcgccat attctgttta aggttccatc gaaacattac gatgatttct       120
     ctactttcat ttttgactag tattattaat tactccatct attttaataa acaagaaggt       180
     attggttatt tagtaccgat tataggaatg ctgataactt tcctttattt agctgctata       240
     gagaagcttt ctattatgtg ggcacttgta gtgactgttg caggaggtgt cattatacct       300
     cttattattc aaattatgat catatttgct tcacttggat tttttagtcc ttctgaattg       360
     aaagagcata tttggaggaa ttatgcaatg gatattacat ctggttttag ctatgcttta       420
     ttagcatttg ttctttattc tcaagagtgg acttttaaat ttgatttcga aaaaatacgt       480
     tttaaatatg agaaatatat agtgatagga atttctcttg ttgcggcaat tgttctacct       540
     gcttcaatgt ttatgacaca tgtaaaaggt actgatttga atttaatatt tttaactatt       600
     agctcaactt tagtatttat tctactttta atattttcca taagaaaaga acggacagaa       660
     aaacagtttg acaaaacaat taaggaggta aaaacgaatg ctcaaaaaaa tgatgtttaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page