(data stored in ACNUC9435 zone)

EMBL: CP000904.PE251

CP000904.PE251       Location/Qualifiers
FT   CDS_pept        361481..362068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5721"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5721"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46675"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV4"
FT                   /protein_id="ABY46675.1"
FT                   /translation="MSNKDKSNIFEKTFGELLENNKEENDAVIDQSRDKLEEVLLRAEG
FT                   KKILSHEDRGESTEGYISPSIKDEKLEEFVGEMPLPPINREQESRAVSIGLQEIREMKE
FT                   YMLYIHRYMINEFNRIYASFPILFAKDFEDKFGTAHKELATIMEDIERFIIGDIYNVEA
FT                   VKNDFKLVQTLEGKRLSILYDFLEYQNNKKLQ"
     atgtcaaaca aagataaatc aaatatattt gaaaaaacat ttggtgaact actagaaaac        60
     aacaaagaag agaatgatgc ggtgattgat caatcgagag ataaattaga agaggtcttg       120
     ttaagagcag aagggaaaaa aatcttatcg catgaagata ggggggaatc aactgaggga       180
     tatatttctc cttccattaa agatgaaaag ttggaagagt ttgtaggtga aatgccatta       240
     cctcctatta atagagaaca agaatcaagg gctgtatcta ttggtttaca agaaattcgg       300
     gaaatgaagg agtacatgct gtatattcat cgttatatga ttaatgaatt taatcgaatt       360
     tatgcttcat ttccaattct gtttgcaaaa gactttgaag ataaattcgg cactgctcat       420
     aaggaattag ccacaataat ggaagatatc gagcgtttca ttattggaga tatttataat       480
     gtagaggcag tgaaaaatga ttttaaactc gttcaaaccc tcgaaggaaa gcggctgtca       540
     atcctctatg attttttaga atatcaaaat aataaaaaat tacaataa                    588
//

If you have problems or comments...

PBIL Back to PBIL home page