(data stored in ACNUC9435 zone)

EMBL: CP000904.PE252

CP000904.PE252       Location/Qualifiers
FT   CDS_pept        362131..362409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5722"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5722"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46676"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV5"
FT                   /protein_id="ABY46676.1"
FT                   /translation="MIFKVKQLLQILHRDEVVYMENKQIVSYNAQSRGHKTKGNTYKER
FT                   YVENTCPECQNPRAYKDEWKTRIKYTCLKRACRHQWFEKKEFPEVKE"
     atgattttta aggtaaaaca actgttacaa attttgcata gggatgaggt agtttatatg        60
     gagaacaaac aaatcgtatc atataatgca caatcaagag gtcataagac aaaggggaat       120
     acatacaaag aacgttacgt cgagaataca tgcccggagt gtcaaaatcc tcgtgcatat       180
     aaagatgaat ggaaaacaag gattaagtat acatgcttaa agcgtgcttg ccgtcatcag       240
     tggttcgaaa agaaagagtt tcctgaagtt aaagaataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page