(data stored in ACNUC9435 zone)

EMBL: CP000904.PE253

CP000904.PE253       Location/Qualifiers
FT   CDS_pept        362534..363271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5723"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; KEGG: lmo:lmo2522
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5723"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46677"
FT                   /db_xref="GOA:A9VUV6"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV6"
FT                   /protein_id="ABY46677.1"
FT                   /translation="MKTKIKKGKIIQNCLKVTAATVVASGVGFQFYEIQELNKEVKSLE
FT                   KNHKQTVLELKTANEKNKVLEEQKKQIAANTEQLSIELEEIKNENEAINQGKHQSLEEN
FT                   QKLQAENADLAKQLREAKESARPVMPEKPSSDKSDPPTAKDTSVSRTIMGIGTAYTLNE
FT                   PGVTGITASGKTIQPGMIAMDRSVPMGTRVRITCDSYPYINGIYTVEDRGGAIKGNIVD
FT                   IYMTDADRMNDFGRRDIKIECLN"
     atgaaaacaa aaatcaaaaa gggaaaaata atacagaact gtttaaaagt cacggcagca        60
     accgtagtgg ctagcggtgt aggatttcaa ttttatgaga ttcaagagtt aaacaaagaa       120
     gtgaaatcct tagagaaaaa ccataaacaa actgtcctag aattaaaaac cgcgaatgaa       180
     aaaaacaaag tattagaaga acaaaaaaaa caaattgcag ctaatacaga acagctttct       240
     attgaattag aagaaataaa aaatgaaaac gaagctatta accaggggaa acatcagtct       300
     ctagaagaga atcagaaact tcaagcagag aatgcagatt tagctaagca attgcgcgaa       360
     gcgaaggaat ctgccaggcc agtgatgcct gaaaaaccat catcagacaa atctgatcct       420
     cctactgcta aagatactag tgtttctaga acgattatgg ggattggtac tgcttataca       480
     ttaaacgagc caggagttac aggtataaca gcttcaggta agacaataca accaggtatg       540
     attgcaatgg atcgctcggt tccaatggga acaagagtaa gaattacatg tgattcttat       600
     ccatatatta acggaattta cactgtcgaa gatcgaggtg gtgctataaa aggaaacata       660
     gtagacattt atatgacaga tgctgacaga atgaatgact ttggacgaag agatatcaag       720
     atagaatgtc ttaactag                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page