(data stored in ACNUC9435 zone)

EMBL: CP000904.PE254

CP000904.PE254       Location/Qualifiers
FT   CDS_pept        364877..365584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5725"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sae:NWMN_1328 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5725"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46678"
FT                   /db_xref="GOA:A9VUV7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV7"
FT                   /protein_id="ABY46678.1"
FT                   /translation="MYRLLLLEDEVEIGSTLEMILRSENYHIDWFTTGDEAVNAAVSND
FT                   YDLMILDVMLKKTVGELNTRISNGLEVARLVNQKKKIPYLLLTSRSEPLDIMQGLDMGA
FT                   EDYITKPYDLTVLLARIRTVLRRSCSNDISNGGITRCGNIEINLLTHKVIVEGKHVHLT
FT                   KQLFELLHYFIIHKGQIISKEELYKNIWGYDPSELQETNTLEVNIRRLRNSLDVDIIKT
FT                   VRGKGYVLEVSSC"
     ttgtacagat tattattact tgaagatgaa gttgaaatcg gtagcacact tgaaatgatt        60
     ttaagaagcg aaaattatca tattgattgg tttactactg gtgatgaagc agtcaatgct       120
     gctgtatcta atgattatga cttaatgata ttagatgtca tgttaaagaa aacagtggga       180
     gagttaaata ctcgtatttc aaatggcctt gaagttgcaa ggttagtgaa tcaaaaaaag       240
     aaaattccat atttactcct gacatcaaga agcgaaccgc tagatattat gcaaggctta       300
     gatatgggag cagaagatta tataacaaaa ccatatgact taacggtgtt gcttgcgaga       360
     atccgaacag ttttaagaag aagttgtagt aacgatattt ctaacggagg aattactcga       420
     tgcggtaata ttgagattaa tttattaacg cacaaagtaa ttgttgaggg taagcatgtt       480
     catttaacta aacaactttt cgaattatta cattacttca tcattcataa gggacaaatt       540
     atttctaaag aagaattata taaaaatatt tggggatatg atccttcaga acttcaagaa       600
     acaaatactc tggaagtaaa tatccgtagg ttaagaaatt cacttgatgt tgatataatc       660
     aaaacagttc gaggtaaggg ttatgttctt gaagtctcta gttgctag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page