(data stored in ACNUC9435 zone)

EMBL: CP000904.PE255

CP000904.PE255       Location/Qualifiers
FT   CDS_pept        365559..367049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5726"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ppe:PEPE_0715
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5726"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46679"
FT                   /db_xref="GOA:A9VUV8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV8"
FT                   /protein_id="ABY46679.1"
FT                   /translation="MFLKSLVARRIKNNKLHMKIMAVAVIAVTLITIPIQLLFFVSVVL
FT                   KNGEEAFSHIKYRAIQIENEAWRIGGGDKIHQEFFDGILLKGEEIKVSSAAKNTEYTFY
FT                   IKQNEEAISSVDKYFSAFLIETLVKRHQKEINKLGNISIRNDETNGLYYMTYKHTFKHG
FT                   DNNETIIVKRNVTPIVIKLIEKYQKEFFIYLLYFIIAISIFIYFGLGLVFRFFGKALDK
FT                   SFVELKEKDYKARIDIKDSYGKEISNVQHQINGILEQMQNNIEVNIESMQDVSHEVNNK
FT                   LTSIKQSIDVLRFYGTNNKLIVEQKLKSIDDNIEQITKVMSTFLDLAKLDRGIYMDATK
FT                   SRDVKEMIENYLQYIKKVFPDFDFIGKYDVRSPSIHFSKEHFVLALNPIIENAVRYSLQ
FT                   SNEIVIHIRKGKYLNYVYIDIINWGIQIEKEEIPQLFNRYYRGKNIENSMKGFGMGLTI
FT                   SKKVMHLYKGKIHVKSYEDGKNIFTLIIPLHQESRGDT"
     atgttcttga agtctctagt tgctagaagg ataaaaaata ataaattaca tatgaagata        60
     atggcggtgg cagtcattgc tgttacctta attacaatac ccattcagct actatttttt       120
     gtttctgttg ttttaaaaaa tggggaagaa gcgtttagtc atatcaagta cagggcgatt       180
     cagattgaaa atgaagcttg gagaattggc gggggtgata agatacatca ggaatttttt       240
     gatggaattc tattaaaagg tgaagaaata aaagtttcat ctgcagcaaa aaacactgaa       300
     tacactttct acattaaaca aaacgaagaa gcaataagta gtgtagataa atacttttca       360
     gcctttttaa tagaaacttt agttaaaaga catcaaaaag aaataaataa attaggtaac       420
     atatcaattc gtaacgatga aacaaacggc ctgtattata tgacttataa gcatactttt       480
     aaacatggag ataataatga aacaattata gtaaaaagaa acgtaacacc aattgttata       540
     aagctaatag agaaatatca aaaagaattt tttatttact tattgtattt cattattgct       600
     ataagtatat ttatctattt tggacttggc ctagtatttc gtttctttgg gaaagctctg       660
     gataaatcat ttgtggagtt aaaagaaaag gattacaagg ctagaataga cataaaggat       720
     agttatggaa aagaaataag caatgttcag catcaaatca atggtattct cgagcaaatg       780
     caaaataata ttgaagttaa tatagagtcc atgcaggatg tttcacatga ggtaaacaat       840
     aagttaacct caattaaaca atctattgat gtgctacgat tttacggaac aaataataaa       900
     ctaattgtag aacaaaaact aaagtcaata gatgataata ttgaacaaat tacaaaagtt       960
     atgtctacat ttctcgatct tgcaaaatta gaccggggaa tttatatgga tgctacaaaa      1020
     tctcgggatg taaaagaaat gattgagaat tacctacaat atataaaaaa ggtttttcct      1080
     gattttgatt ttattggtaa atatgatgta agatcgccaa gtattcattt tagtaaagaa      1140
     cattttgtat tagccttaaa tcctatcatt gaaaatgcag ttaggtattc attgcagagt      1200
     aatgagatag tcattcatat tcgaaaaggt aaatatttaa actacgtata tattgatatt      1260
     attaattggg gtattcaaat cgaaaaagag gaaatcccac agttatttaa tagatattac      1320
     agagggaaga atattgaaaa ttcaatgaaa gggttcggaa tgggtttaac aatatccaaa      1380
     aaagtgatgc atttatataa ggggaaaatt catgtaaaga gttatgaaga tggcaaaaac      1440
     atttttacat taatcatacc cttgcatcag gaatcgagag gtgataccta a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page