(data stored in ACNUC9435 zone)

EMBL: CP000904.PE256

CP000904.PE256       Location/Qualifiers
FT   CDS_pept        367049..368578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5727"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: ser:SERP0988
FT                   sensor histidine kinase ArlS"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5727"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46680"
FT                   /db_xref="GOA:A9VUV9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUV9"
FT                   /protein_id="ABY46680.1"
FT                   /translation="MGNKIRKFLNNFVKRDKLRVQVVLLTLILVLVSAIPVNLFSIYNE
FT                   LQLTTQREFESMFSRVEKIQDKIVLSGISASQELDSEFFKQISYPGESMKIRMGEQGAQ
FT                   DYHYAAEYEQNDKFGMFEAQILTLFVPTFFDSIKAHMKSLDATADKDSYSFYIDEKNKA
FT                   YGEILHSFKHKSHYDTIIIKKDITPNLKMQMVNSMENFLYMFIWFFFFSVVSVLVCLKF
FT                   IFKPLQSAMDSSFENVVDNNYQTRIEDPLYGEEISKIVHRFNAVLDRMHELVQNNLNSM
FT                   QDVSHEIKTYLTAIKQSVDVIKLYGKSDEKLVAEKLNAIEDNIIRATAIISTTLELARL
FT                   KQIPNIDSANYYDVKYLVNFLLRFKQETYPSFIFETDYDSEDVEIFIDRNHFFLMMSPI
FT                   LDNAVKYSMNSNIVKIDTISKRIDNMVYISIANTGVVIDQKEIPFLFDRYYRGKNLGNS
FT                   KQGSGLGLTIAKEVMDLYKGRITVHGTAAGVTSFILSFPKAIRREDSGNLS"
     atgggaaata agattaggaa atttctcaat aattttgtga aacgtgataa actacgtgtg        60
     caagtagttt tattaaccct tatacttgtt cttgtttcag caataccagt caatttattt       120
     tctatttata atgagctaca actaacaact caaagagaat ttgaatctat gttttccagg       180
     gtagagaaaa tacaggacaa aatagtttta tcaggaataa gtgcatcaca ggaacttgat       240
     tctgagttct ttaagcagat tagctatcca ggtgaatcaa tgaaaattcg catgggtgaa       300
     caaggagcac aagattatca ttatgcagct gagtatgaac agaatgataa atttggtatg       360
     tttgaagctc aaatactgac cttattcgtc ccaacctttt ttgattctat taaagcacat       420
     atgaaatcac tagatgctac tgcagataaa gatagttata gtttttatat tgatgaaaaa       480
     aataaagcat atggtgagat tttacattct tttaaacata aaagtcatta tgacacgata       540
     atcataaaaa aagatataac acctaatttg aagatgcaaa tggttaatag catggaaaac       600
     ttcctatata tgttcatttg gtttttcttc ttttcagttg tgtcagtatt agtatgttta       660
     aaatttattt ttaaaccatt acaaagtgca atggattcaa gttttgaaaa tgtagtagat       720
     aataattatc aaacaaggat tgaagatcct ttgtatggag aagaaatatc aaaaattgtt       780
     catcgtttta atgcagtatt agacaggatg catgagcttg tacaaaacaa ccttaattcc       840
     atgcaagatg tatcgcatga gataaagaca tatcttacgg caatcaaaca atctgttgat       900
     gttattaaat tatatggaaa aagtgatgaa aaactagttg ctgaaaaact aaatgctatt       960
     gaagataata taattagggc aacggccatt atatcaacta cgctggaact agcccgtttg      1020
     aaacaaatcc caaatattga tagtgccaat tactatgacg tgaaatattt agtaaatttc      1080
     ttgttaagat ttaagcaaga aacctatccg agttttattt ttgagacaga ctatgattct      1140
     gaagatgttg agatatttat agacaggaac cattttttct taatgatgag tccaattctt      1200
     gataatgctg ttaagtattc aatgaattca aatatagtta aaatagatac tatttctaaa      1260
     agaattgata atatggttta tatttccatt gctaatacgg gggttgttat tgatcaaaaa      1320
     gagattcctt ttctctttga tcgttattat cgtgggaaaa atttggggaa ttcaaaacaa      1380
     ggatctggtt taggcttgac catagctaaa gaagtaatgg atctgtataa aggtagaata      1440
     actgttcatg gcacagcagc tggagtaaca tcttttatat taagttttcc aaaggccatt      1500
     agaagagaag actcaggaaa tttatcctga                                       1530
//

If you have problems or comments...

PBIL Back to PBIL home page