(data stored in ACNUC9435 zone)

EMBL: CP000904.PE257

CP000904.PE257       Location/Qualifiers
FT   CDS_pept        complement(368768..369037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5728"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5728"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46681"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW0"
FT                   /protein_id="ABY46681.1"
FT                   /translation="MKIYRGNIGVDLSLEEFSRLIVDEEKIDDLLNLIYTLEMDEIMNY
FT                   NRDDIQALEESLFQEIAEYQRKQNSNDTTAKMEYILAHLKKYER"
     ttgaagattt accgtggtaa tataggggta gatttatctc ttgaagaatt ctctagactt        60
     atagtagatg aagagaaaat tgatgacttg ctcaacctca tatatacatt ggagatggat       120
     gaaataatga actataatag agatgacatt caagctcttg aagaaagcct attccaagaa       180
     attgcagaat accaacgcaa acaaaattca aatgacacaa ctgcaaaaat ggagtatatc       240
     ttagcccatt taaaaaaata cgagcgttaa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page