(data stored in ACNUC9435 zone)

EMBL: CP000904.PE258

CP000904.PE258       Location/Qualifiers
FT   CDS_pept        369686..370018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5729"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5729"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46682"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW1"
FT                   /protein_id="ABY46682.1"
FT                   /translation="MNKQEAIEIIKNSFYHLMFEENVKVGSINVLLYFPSIGIAVLEPN
FT                   KDRRHLLIEDNIEDMDELYIKKELKAKPIYLDLENDEFNIGFVINDILLEARFAPAENF
FT                   LESRGT"
     atgaataagc aagaagcgat agagatcatt aagaattctt tttatcattt aatgttcgaa        60
     gaaaatgtta aagtgggttc aattaatgtt cttttgtatt ttccatctat aggcatagca       120
     gtgttagaac ctaataaaga tcgaagacac ttacttatag aggataatat tgaagatatg       180
     gatgaactct atattaaaaa agaattgaaa gctaaaccca tttatttaga tttggaaaac       240
     gatgaattca atattggatt tgttatcaat gacatactgt tggaggcaag atttgcacca       300
     gcagagaatt ttttggagag tagaggtacc taa                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page