(data stored in ACNUC9435 zone)

EMBL: CP000904.PE259

CP000904.PE259       Location/Qualifiers
FT   CDS_pept        370644..371078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5730"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46683"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW2"
FT                   /protein_id="ABY46683.1"
FT                   /translation="MREMRYGLSGYLAPDGIFYECDYGKHSELANELIEKYKIKNKTNY
FT                   NEIATRGEFLKFGTYPWSSKEGCSGCHVFKSLFHPLSNKQSIWINENLDKLTDKQRSEL
FT                   NRLLDQEELIRNKLAMESKKDVEKIQISYRVGTRLSAVGV"
     atgagagaaa tgagatatgg gttatcggga tatttagcac cggatggtat tttctatgaa        60
     tgtgattacg gtaagcatag cgaacttgcc aatgagctta ttgaaaaata taaaataaaa       120
     aataaaacga actataacga aattgcaact aggggagaat ttttaaaatt tggcacatat       180
     ccttggtcaa gtaaagaggg gtgtagtggt tgccacgttt ttaaaagtct attccaccca       240
     ttatctaata agcaatctat atggataaat gagaatttgg ataaacttac tgacaagcaa       300
     cgttctgaat tgaatagatt acttgatcaa gaagagctca taagaaataa attagctatg       360
     gagagtaaga aagatgtgga aaaaatacag atttcatata gagttggtac aagattatca       420
     gctgttggtg tttaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page