(data stored in ACNUC9435 zone)

EMBL: CP000904.PE26

CP000904.PE26        Location/Qualifiers
FT   CDS_pept        complement(48714..49163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5459"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: cvi:CV_0866
FT                   probable transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5459"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46450"
FT                   /db_xref="GOA:A9VV18"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV18"
FT                   /protein_id="ABY46450.1"
FT                   /translation="MTNSINKINAIDELSQAIYSLTAADGRLRGRATRTLGAVSMVHAR
FT                   TLKVLAEEGELSVKELADRAETTAAGITQLINGLQQAGYVERVRSNNDRRVVKVRLTPI
FT                   GLNCHLEREEKLKHILNANLSDFDADQIEKSSEIIRCLVHVLDQL"
     atgacaaatt ctataaataa gataaatgca atagacgaac ttagtcaggc catatatagt        60
     ctgactgcag ccgatggacg tttaagaggg cgagctactc gtacattagg agcagtttca       120
     atggtccatg ctcgaactct taaagtatta gctgaagaag gcgaattatc agtcaaagaa       180
     ttagctgatc gagcagaaac taccgccgct ggtattactc aattaatcaa tggattacaa       240
     caagcaggct acgttgagcg tgttcgttca aataacgacc ggagagttgt caaagtccgg       300
     cttacgccta ttggtttaaa ttgtcattta gaaagggagg aaaaactaaa acatattctt       360
     aatgcgaacc tttcagattt tgatgcagac caaatcgaga aatcttctga aataattagg       420
     tgcctagttc atgtgcttga tcaactataa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page