(data stored in ACNUC9435 zone)

EMBL: CP000904.PE260

CP000904.PE260       Location/Qualifiers
FT   CDS_pept        complement(371939..372376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5732"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46684"
FT                   /db_xref="GOA:A9VUW3"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW3"
FT                   /protein_id="ABY46684.1"
FT                   /translation="MTPDEIGIIEKIFVSITEGDKPFMVLFAIIMLFAIFMSIKVMGYV
FT                   RSVSDSHKDQMTSMNENMKEQREDHYKMIAEDRLRSDNRERELFVNLEKNTQQLEGIAT
FT                   TLKEVQFNFTSLENKVTQNFDYLEKEIESVKIKVSKKENYE"
     atgactccag atgaaattgg cattatcgaa aagatttttg ttagcattac tgagggtgat        60
     aaacctttta tggttctctt tgcgattatc atgctatttg ctatctttat gtccataaag       120
     gttatgggat atgttcgtag tgttagtgat agtcacaagg atcaaatgac ctctatgaat       180
     gaaaacatga aagagcagcg tgaagaccat tataaaatga tagcggaaga tcggcttcgc       240
     tctgacaatc gtgaaagaga attattcgta aacttagaaa agaacaccca acagcttgaa       300
     ggtattgcta caacattaaa agaggtacaa ttcaatttca ctagcttaga aaacaaagtc       360
     actcaaaact ttgattatct agagaaagaa attgaaagtg ttaagattaa agttagtaaa       420
     aaagaaaact acgagtaa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page