(data stored in ACNUC9435 zone)

EMBL: CP000904.PE261

CP000904.PE261       Location/Qualifiers
FT   CDS_pept        complement(372909..373163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5733"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5733"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46685"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW4"
FT                   /protein_id="ABY46685.1"
FT                   /translation="MIEYIENDNSDKPQVNIYIGEDEWAKYSFQNKVRLLYRLKNSDNV
FT                   LAKELVKSISSLIEEEQKMSEIDYEATVKQCENMIEWFE"
     atgatcgaat acattgaaaa cgataattca gataaaccac aagttaatat atatatcgga        60
     gaagacgaat gggcgaaata ttcttttcaa aacaaagttc gattattgta tcgacttaaa       120
     aactccgaca atgtactagc taaagaattg gtaaaatcta tttcttcatt aatagaagaa       180
     gaacaaaaga tgagcgagat tgattacgaa gcaacagtaa aacaatgtga aaatatgatt       240
     gaatggtttg aataa                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page