(data stored in ACNUC9435 zone)

EMBL: CP000904.PE263

CP000904.PE263       Location/Qualifiers
FT   CDS_pept        373499..373957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5735"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46687"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW6"
FT                   /protein_id="ABY46687.1"
FT                   /translation="MNYMKKIDEAIELFKNLISATTNEAKSAVLATNQDNEIADKLLVL
FT                   LKNKTLYLPALTLLPSITKNDSNKRLRNYVSFVNAIDKLEGKKLNAYVFDYVLRHIDEE
FT                   ELKMYKAILTNADLVPVVKEPVDETVLEEKIQEEVTQVEKIQEDVESE"
     atgaattata tgaagaagat tgatgaagcg attgagttat tcaaaaattt aattagtgca        60
     actacaaatg aagccaagtc ggctgttctt gcaactaacc aggacaacga gattgctgat       120
     aaacttttag ttcttttaaa gaataaaacg ttatatcttc cagccctaac tttgttgcct       180
     tccattacta agaatgacag caataaacgt ttaaggaatt atgttagctt tgttaatgct       240
     attgataagt tagaaggcaa aaagctaaat gcatatgtct ttgattacgt acttcgtcat       300
     attgatgaag aagaattgaa aatgtacaaa gctattttaa cgaatgctga cttagtacca       360
     gttgttaaag aaccagtgga tgagactgtg ttagaagaaa aaattcaaga agaagtgact       420
     caagtagaaa agattcaaga agacgttgag tcagaataa                              459
//

If you have problems or comments...

PBIL Back to PBIL home page