(data stored in ACNUC9435 zone)

EMBL: CP000904.PE264

CP000904.PE264       Location/Qualifiers
FT   CDS_pept        374646..374891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5737"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46688"
FT                   /db_xref="GOA:A9VUW7"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW7"
FT                   /protein_id="ABY46688.1"
FT                   /translation="MKKFIETLKKEIKEILDCCKKPLWKLRYFFYGWALGGAIGTTYFY
FT                   KIGEIDEYGVLLRITAAIILFILPLAYGEKNEVGSG"
     atgaagaaat ttattgagac attaaaaaaa gaaataaaag aaattcttga ctgctgcaag        60
     aaacctttat ggaaattaag atatttcttt tacggatggg cattgggggg agctataggt       120
     acaacttatt tttacaaaat tggtgagata gacgaatatg gagtgcttct tcgtatcacc       180
     gcagccataa ttttgtttat tctcccattg gcttatggag agaaaaatga ggtaggatct       240
     ggttga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page