(data stored in ACNUC9435 zone)

EMBL: CP000904.PE265

CP000904.PE265       Location/Qualifiers
FT   CDS_pept        375493..376014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5738"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46689"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUW8"
FT                   /protein_id="ABY46689.1"
FT                   /translation="MIVGDIIVVSGKSLISKIIQKVAGSKWTHVALYIGGGYIIEIDWN
FT                   TKSSIVREKYSISNLECMVLRNKNALTKEQQDIIISTAVSYQRKGFRYDWLRLISLYLK
FT                   SKFPNNKLIDKLDRRNKFICTELVDEILKEAGIDLFPNQGGDIFPHDYLACEQLIALNK
FT                   VKWSSYKKAN"
     atgatagtag gcgatattat tgtcgtaagt ggaaagtctc ttatctcaaa gataattcaa        60
     aaggtggcag gttctaagtg gacacatgta gctttgtata ttggtggagg atatatcata       120
     gagatagatt ggaatactaa atcctctata gtaagggaaa aatattctat tagtaattta       180
     gaatgtatgg tgttaagaaa taagaatgcg ttaacgaaag aacaacaaga tattattatc       240
     tctacagcgg tttcatatca gagaaagggt tttcgatatg attggctccg attaatttct       300
     ctatatttaa agtcgaaatt tccaaataac aaactaatag ataaactaga tagaaggaat       360
     aaatttattt gtacagaact ggtggatgag attttaaaag aagcaggtat tgatctgttt       420
     ccaaaccaag gtggggatat tttccctcat gactacctcg cttgtgaaca attaatagcg       480
     ttgaataaag ttaaatggtc gagttataaa aaggctaact ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page