(data stored in ACNUC9435 zone)

EMBL: CP000904.PE267

CP000904.PE267       Location/Qualifiers
FT   CDS_pept        378529..378786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5741"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46691"
FT                   /db_xref="InterPro:IPR025915"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX0"
FT                   /protein_id="ABY46691.1"
FT                   /translation="MEGLRYERFEQNLLDHWVKLKESAKVGLKTTVVCLQMNNGFEVVG
FT                   QSACMNPDEYDYELGVYYATKDALKRIADIVAYIEHEGTF"
     atggaaggac ttaggtacga acgatttgaa caaaacttac ttgatcattg ggtgaaactt        60
     aaggagtcag caaaggtggg actaaagact actgttgttt gtcttcaaat gaacaatgga       120
     tttgaagtag ttggacaatc agcttgtatg aatccagatg agtacgacta tgaactaggt       180
     gtctattacg ctacaaaaga cgcgcttaaa agaatcgctg atattgtagc ttacattgaa       240
     catgaaggta ccttttag                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page