(data stored in ACNUC9435 zone)

EMBL: CP000904.PE268

CP000904.PE268       Location/Qualifiers
FT   CDS_pept        379097..379576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5742"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5742"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46692"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX1"
FT                   /protein_id="ABY46692.1"
FT                   /translation="MATKEREIETYDTSSFLQKNRSKVAMGAVGGFAYGAKHLIQTQPV
FT                   QGLVKSEIFDEEKGIFKKAKKGSRMQFSGKKLGTAIGKGHYAVTATVLDVGRRIEGYDD
FT                   TEEIKGEQEFQLRKKMKKQREKNRNLYGNINQGEVVFNLFESRTGHHKMGNAKFN"
     atggctacta aagagcgtga aattgaaact tacgatacat ctagttttct acaaaagaac        60
     aggtcaaagg ttgcaatggg tgcagttggt ggttttgcct atggagcgaa acacttaata       120
     caaactcaac ctgtgcaagg tttagtaaaa agtgaaattt ttgatgagga aaaaggaatt       180
     ttcaagaaag ctaaaaaggg aagtagaatg caattttctg gaaagaagct tggaactgct       240
     atcggcaagg gacattatgc tgttactgct actgttttag atgtaggacg ccgaattgaa       300
     ggatatgatg atacagaaga gattaaagga gaacaagaat ttcaacttag gaaaaaaatg       360
     aagaagcaaa gagagaagaa tagaaattta tatgggaaca taaatcaagg agaagtcgta       420
     tttaatcttt ttgaatccag aacaggtcat cataagatgg ggaatgctaa atttaattag       480
//

If you have problems or comments...

PBIL Back to PBIL home page