(data stored in ACNUC9435 zone)

EMBL: CP000904.PE269

CP000904.PE269       Location/Qualifiers
FT   CDS_pept        380203..380601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5743"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46693"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX2"
FT                   /protein_id="ABY46693.1"
FT                   /translation="MAILNSIKNFAKIGVLNTKKAVNGVKNAPNNIIKSTFIDTKNKKK
FT                   TLANLYTGKRINPKHFAVVGGGYLAFNQAKMSFEYQMEPLKRATMNDYQYIGSPEIMMY
FT                   DGVGQERVSKNLNVDGSIVFDLHNNRRG"
     atggctattt taaattcaat taaaaatttt gctaaaatag gtgttctaaa tacaaaaaag        60
     gccgtaaatg gtgttaaaaa tgctccaaat aatattatta agagcacttt tattgataca       120
     aaaaataaga aaaagacatt ggctaatctt tacactggta aaagaataaa tccaaaacac       180
     tttgctgttg ttggaggggg atatcttgct tttaatcaag ctaagatgag ttttgaatat       240
     caaatggaac ctcttaaacg agcgaccatg aatgactatc agtatattgg atcgccagaa       300
     attatgatgt acgacggtgt agggcaagaa agagtttcta aaaatttaaa tgttgatgga       360
     agtattgtat ttgatcttca caataataga agggggtaa                              399
//

If you have problems or comments...

PBIL Back to PBIL home page