(data stored in ACNUC9435 zone)

EMBL: CP000904.PE27

CP000904.PE27        Location/Qualifiers
FT   CDS_pept        49411..50685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5460"
FT                   /product="protein of unknown function DUF1100 hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF1100 hydrolase
FT                   family protein; KEGG: cvi:CV_0865 probable dipeptidyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5460"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46451"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV19"
FT                   /protein_id="ABY46451.1"
FT                   /translation="MTQRSQSQGWALDIALALGGFDALHPEAKATMEQLGHDHTDFDKV
FT                   FSQVKSGAMIPKAWATVAAQAQERAKHYEQKGFTVTARDLYQRAAVMWGRAQYSYFNDD
FT                   PRKLAFRERCNECVAAISSLGGGTVQRIVLEFEGKQIYALLHLPSGEIRNAPAVILGPG
FT                   MDMIKEDYIQIAQRYYTSRGIVALSIEGPGQGESVSGGLKVDLANYERAVSCYIDFLSK
FT                   RPEVDPNRIGFFGISMSGYWGMRAAASDNRINAIATFEGVYGEFDTIFNRAQPSFKANF
FT                   MYMSGYTDEVAFENELSSQMNLWKLAPKITCPVFMGIGEFDELTRLEEALSLYELVEAP
FT                   KELRVYENEFHPLGGVAAEIFRFGAEWVELALEGNFKNDYDERYYMHRDGGVTEGTAFP
FT                   TYWLGAQPAEIKARKKCNTLNACKS"
     atgactcaac gttcacaatc tcaaggatgg gctttagata tagctcttgc acttggtggg        60
     tttgatgctt tgcaccctga agcaaaggca actatggaac agttaggaca cgaccacact       120
     gattttgata aagtattttc tcaagtaaag agtggagcaa tgataccaaa agcatgggcc       180
     acggttgctg ctcaagctca agaacgagca aaacattatg aacaaaaagg atttacagtt       240
     actgcccgtg atttgtatca gcgagctgct gttatgtggg gacgtgctca atattcatat       300
     tttaatgatg atccacgaaa attagcgttt cgagagcgtt gtaatgaatg tgtggcagct       360
     atttcgtcac ttggaggggg aacggtacaa cgtatagtat tagaatttga aggcaaacag       420
     atatatgcac tacttcattt accttcaggt gaaattcgta atgcaccagc agtaatatta       480
     ggcccaggta tggatatgat taaggaagac tatatacaga ttgcgcaacg ctattatacg       540
     tctcgtggta tcgtagctct atcaattgaa ggaccaggtc aaggtgaatc tgtatcagga       600
     ggtctaaaag ttgatttggc taattacgaa cgcgccgtta gttgttatat cgattttcta       660
     tcaaaacgac ctgaggttga tcccaatcgg attggatttt ttggtatcag tatgagtggg       720
     tattggggga tgcgcgctgc tgcgagtgat aatcgtataa acgctatagc gacctttgaa       780
     ggtgtatatg gcgaatttga taccatcttc aaccgagcac agccgagttt caaagcaaac       840
     tttatgtaca tgtctggcta cactgatgag gttgcctttg aaaacgagct gagtagccag       900
     atgaacctat ggaaattggc tccaaagatt acttgtccag tcttcatggg tataggagaa       960
     tttgatgaac taacccgttt ggaagaagca ttaagtcttt atgagcttgt agaagcacca      1020
     aaggagctgc gcgtctacga gaatgaattc catccgcttg gtggagtagc tgcagaaatt      1080
     ttccgttttg gtgcagaatg ggtagaactt gcacttgaag ggaactttaa aaatgactat      1140
     gatgaacgtt attacatgca tcgtgatggc ggtgtcactg aggggactgc atttccaact      1200
     tattggcttg gtgctcagcc ggctgaaatt aaagcacgta aaaaatgtaa cacattaaac      1260
     gcttgtaaga gttaa                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page