(data stored in ACNUC9435 zone)

EMBL: CP000904.PE270

CP000904.PE270       Location/Qualifiers
FT   CDS_pept        380607..381002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5744"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5744"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46694"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX3"
FT                   /protein_id="ABY46694.1"
FT                   /translation="MKVKSMIKTLTSPQAIFGYNVARGLHGGDSLGTSVAKASIKGVLS
FT                   ASNPVLFGVVTWGSLAQKGYWGLLEFNHQREQWWKAQYATSNVVGGNFLDTRGAQTMRQ
FT                   AAVQAIQGSKMNARSALGGEAKILSPY"
     atgaaagtaa agtcaatgat taagacatta acctcacctc aagctatatt tggatataat        60
     gttgcaagag gcttacatgg gggtgacagc ttaggtacat cggtggctaa agcatctatt       120
     aaaggggttt taagtgcttc taaccctgtt ttgtttgggg tggtaacctg gggaagctta       180
     gcgcaaaaag gttactgggg tttattagaa ttcaatcacc aaagggagca atggtggaaa       240
     gcgcagtatg caacaagtaa cgtagttggg ggtaactttt tagatacgcg aggggctcaa       300
     acaatgagac aagcagctgt acaggctata cagggaagta agatgaatgc aagaagtgca       360
     cttggtggag aagctaaaat attaagccct tactaa                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page