(data stored in ACNUC9435 zone)

EMBL: CP000904.PE271

CP000904.PE271       Location/Qualifiers
FT   CDS_pept        381046..382410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5745"
FT                   /product="replicative DNA helicase"
FT                   /note="SMART: Hedgehog/intein hint domain protein; KEGG:
FT                   msm:MSMEG_6892 replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5745"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46695"
FT                   /db_xref="GOA:A9VUX4"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX4"
FT                   /protein_id="ABY46695.1"
FT                   /translation="MSEIINLEREMLQIIHDPVQRGEHHLGGSPSWYQEQIIRQSHHRE
FT                   GLRYGERVGKCIEENQRIINSNTGEYKSIGELYQSQLDGIATPLLTLNEFYQLKNSKAF
FT                   SIEDNGVQDTFAVVTKHGARVTLTRNHPILTVDGWKEVDALCIGERIATPKFLTVYGTK
FT                   QVEKNKLRILAYMLAAGRLNKNSISFQIRYEGVGESLQKSCEAIGITTYHEHHKKATVY
FT                   LMDFRSFEFYREIEEKKIPSFIYELDRDHLAFFLGSLYSAGGWFCAGRISEIGYATKCR
FT                   KFALDLKHLLLRFGIQTNLLQKEMNGSVYYHLMVYHCSSILLFLEHLATPERNYEAVQQ
FT                   RALKMKPSEPTLPKEVWKYIEKERIVKGMTKAEVVGKGNRRYRTEKGISLSNAREYAEN
FT                   LQFAMLHYLIDSHVIWEEVVEIIPYGKRQTYDVFVPETHNLVVEDILVFSPCTNV"
     atgagtgaaa ttattaatct tgaacgtgaa atgctccaaa ttattcacga tcctgttcaa        60
     aggggagaac atcacctagg ggggagccca agttggtatc aagagcaaat tattcgacag       120
     tcacatcatc gcgaaggttt acgttatggt gagcgtgtcg gcaaatgtat agaagaaaac       180
     caacgaatta taaattctaa cacgggagaa tataaatcga taggagagct ttatcagtcc       240
     caactagatg gtatcgctac accattatta acattgaatg agttctatca attaaagaat       300
     agtaaagctt tttccattga agataacggt gttcaagata cgtttgctgt tgtaacaaaa       360
     catggagcac gagttaccct tacaagaaat catccaatac taacagtcga tggatggaaa       420
     gaagtagatg cactctgtat cggagaaaga attgctacac ctaagttctt aactgtgtat       480
     ggcacaaaac aagtagaaaa gaataaactt cgaattcttg catatatgct cgctgcgggg       540
     cgtttaaata agaatagcat tagcttccaa atacgttatg aaggtgttgg tgagtcgttg       600
     caaaaatctt gtgaggcaat tggtattaca acgtatcatg agcatcataa gaaggcgaca       660
     gtctatctaa tggactttag aagttttgag ttttataggg agatagaaga aaaaaaaatc       720
     ccttcattta tttacgagtt ggatagagat cacttagcgt tcttcttagg aagtctgtat       780
     tcggcaggtg gttggttttg cgccggacgt attagtgaaa ttgggtatgc tactaagtgt       840
     cgaaaatttg cattagatct aaaacactta ctattacgtt ttggtatcca aacgaattta       900
     cttcaaaaag aaatgaacgg ttctgtttat taccatctta tggtttatca ctgttcctct       960
     attttattat tcctcgaaca tttagctaca ccagagcgta attatgaagc agtccaacaa      1020
     agagcactga aaatgaaacc ttctgaacca acactcccta aagaagtatg gaaatacatt      1080
     gaaaaggaac gaattgttaa aggaatgacg aaagctgaag tggtaggaaa gggtaatcgt      1140
     cgctatcgta cagaaaaagg tatctcttta agtaatgctc gtgaatatgc agagaattta      1200
     caatttgcaa tgttacatta cttaattgat tctcatgtaa tatgggaaga agtagtagaa      1260
     atcattcctt atggtaagag acagacttat gatgtcttcg ttccagagac tcataaccta      1320
     gtagttgaag atattcttgt atttagtcca tgtacaaatg tttag                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page