(data stored in ACNUC9435 zone)

EMBL: CP000904.PE272

CP000904.PE272       Location/Qualifiers
FT   CDS_pept        383713..385068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5746"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5746"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46696"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX5"
FT                   /protein_id="ABY46696.1"
FT                   /translation="MDELLGKKVELDTELERSIIEYRPRVKYEPNKPFTVNLPTEEIIG
FT                   EDQKEFDEDGSFIPEEKPAKQYDKFVGTLELINELIEYIEKKMKGLQVPISIEELEKLY
FT                   ESQPFFEQDIGDEGFIDFETYQKTFENPEAPANSLIQDIVHSYAEDVEGSLELEFYEDL
FT                   KELHSIVEEGYFLFKETVLKNYLDGNIPKTPENNNGFTEQIEKAVKKQKQWFDQVTNLY
FT                   RNNESKYYDALRTQYGSPEFFKISDEYTKTKRPYDVVVRKEKTLNEVSSLIDGLLIGSQ
FT                   DCSESIKFGLAIGSEIDGEGVMNLLENQASTKEQLTGLLKLTQLSLKLQLNQQIEDKKQ
FT                   YRDVLKNINNLSRKKRAHDELLMALELRNTMYLNMYDSLQHLESPSKAPGVESFLNQMA
FT                   GGLSLVQEQYDSFLQDVYAMYMSEYEVRKEKIDKTLNKENARAGYSLVSEYL"
     atggatgaat tattaggaaa aaaagttgaa ctggataccg aattagagcg ttccattatt        60
     gaatacagac cacgcgtaaa gtatgaacca aataaacctt ttactgttaa tttaccaaca       120
     gaagaaatca taggggaaga tcaaaaggaa ttcgatgaag atggttcgtt tattccggaa       180
     gaaaagccag ctaaacaata tgataaattt gtaggtacac tagagcttat taatgaactt       240
     attgaatata ttgagaaaaa aatgaaaggc ttacaagttc ctatttctat agaagaactt       300
     gagaagttat atgagtcaca accatttttt gaacaagata taggggacga aggtttcatt       360
     gactttgaaa catatcagaa aacttttgaa aatccagaag cacctgcaaa ctcacttatt       420
     caagatattg ttcattcgta cgcagaagat gtggagggta gcttagagtt agaattttat       480
     gaagatctaa aagagttgca ttccatagta gaggaaggat atttcttatt taaagaaact       540
     gttttaaaga attatcttga tggaaatatt cctaagacac cagaaaacaa taacggtttt       600
     actgagcaaa ttgaaaaagc agtcaagaag caaaaacaat ggtttgatca agttacaaac       660
     ctctatagga ataatgagag taaatattat gatgccctaa gaacacagta cggttcacct       720
     gaattcttca agataagtga tgaatataca aaaacaaagc gcccttatga cgttgtggtt       780
     cgtaaagaaa agacacttaa tgaggtgagt tctcttatag atggtcttct tataggttca       840
     caagattgtt ctgaatctat taaatttgga ttagctatag gtagcgagat tgatggtgaa       900
     ggggttatga atttattaga aaatcaggct tctacaaaag aacaacttac cggtttgctc       960
     aaattaactc agctatcatt gaagttacaa cttaatcaac aaattgaaga taagaaacaa      1020
     tatcgagacg tgttaaaaaa cattaacaat ctttctcgta aaaagcgtgc gcatgatgaa      1080
     ttattaatgg cattggaact tcgaaatacg atgtacctaa acatgtacga ttcattgcaa      1140
     catttggaat ctccaagcaa ggcacctggt gtggaatcat tcctaaatca aatggccggg      1200
     ggattaagtc ttgtacaaga acagtatgac tcatttctac aagatgtata tgcaatgtat      1260
     atgtctgaat acgaagtaag aaaagaaaaa atcgataaaa cattaaacaa ggaaaatgca      1320
     agagcaggtt attctttggt atcagagtac ctataa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page