(data stored in ACNUC9435 zone)

EMBL: CP000904.PE273

CP000904.PE273       Location/Qualifiers
FT   CDS_pept        385541..387040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5747"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46697"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX6"
FT                   /protein_id="ABY46697.1"
FT                   /translation="MYTYNQLIFPSHMEKNTRFLVLAGFSLNGPVGTPFIIRDNIEPSY
FT                   ILGDCRLTENVSMAKKYGITPLILRLNGSHGECVVNHDELNTPAFRFKTLEATDESNNI
FT                   AIHLFPTYMIIKGINTSYSYLFADYKGVDDLAFAIKQDLYFGSGEVDVEVINQIPIKGL
FT                   CTSEKHVRFTGADDGFHYVSNHSNPDSEDKIQMQLQLLKDSFITEDGSEVFFTGELSSF
FT                   QVDTLLFTDIPYEKAPGQLSSIFGEFAKTKTTEQSIFCSVVLCSDLFSKSRYTVTGEDT
FT                   YETQVQLLVEKASINTEEHRHLEHIEVVVGIQNSENPKYSFMPVAANYACMRYKLPNFH
FT                   NSATNKQLLNINTLQNRELKKVEVAKLTSSGYICIVPSIKKGFVPYSSRNLYLQNKFYS
FT                   KPHYLRSIGYDVNRIAGFFNQYIGEPLSFVLLQSIITQVDAFIDSLAEDHPIYRDIKME
FT                   VLHYDQENLTLSISFELYGEIETVRTSFTYISSSEVSVSWQ"
     atgtatacgt acaatcaact tattttccct tctcatatgg aaaagaatac tcgttttcta        60
     gtattagcgg gcttttcttt aaatgggcca gtagggacac cttttatcat tcgagataac       120
     atagagccat cttatattct tggtgattgt cgcctgacgg aaaacgtaag tatggcaaaa       180
     aaatacggaa tcaccccact aatccttcgg ttaaatgggt ctcatggaga atgcgttgtt       240
     aatcatgatg aacttaatac tccagctttc cgatttaaaa cattagaagc aacagatgag       300
     tcaaataaca tagctattca cttatttcca acgtatatga ttattaaagg cataaacact       360
     agttattcat acctgttcgc tgattacaag ggagtagatg acctagcttt tgctatcaaa       420
     caagatcttt attttgggtc gggagaagta gatgtagaag ttatcaatca aattccaata       480
     aaaggattat gtacttctga gaaacacgtt agatttactg gggcggatga tggcttccat       540
     tatgtaagta atcatagcaa tccagactca gaagataaga ttcaaatgca attacagcta       600
     ttaaaagata gttttattac tgaagatgga agtgaggttt tctttacagg agaattaagt       660
     agttttcaag tagatacact cctatttaca gatatacctt acgagaaagc acctggacag       720
     ctatcctcta tatttgggga atttgccaag actaagacaa ctgaacaatc tattttctgc       780
     tcagttgttt tatgctctga tttattctct aaaagtcgtt atacggtaac aggagaagat       840
     acatacgaga ctcaagtaca attacttgta gaaaaagcct ctattaatac agaagaacat       900
     cgtcatttag agcacataga agttgtagtt ggtatacaaa actctgagaa ccctaaatat       960
     tcctttatgc cagttgcagc aaattatgct tgtatgcgat ataaactgcc gaatttccat      1020
     aattcagcta caaataaaca actactaaac ataaatacat tacaaaatag agaactcaaa      1080
     aaggtggaag ttgctaaatt aacaagtagt ggttatatat gtatagtacc atcaattaaa      1140
     aaaggatttg ttccttattc ctcaagaaat ctttaccttc aaaacaaatt ttattcaaaa      1200
     cctcattatc tccggagtat aggttacgat gttaatcgaa ttgctggatt ctttaatcaa      1260
     tacattgggg aaccattaag cttcgtatta cttcaatcta tcatcacaca agttgatgcc      1320
     ttcattgata gtcttgcaga agatcatcca atctacagag atataaaaat ggaagtctta      1380
     cattatgatc aagaaaatct tactctatct atttcatttg agttatatgg ggagattgaa      1440
     acggttagaa cttcctttac ttatatttcg tcaagtgagg tgagtgtttc atggcagtag      1500
//

If you have problems or comments...

PBIL Back to PBIL home page