(data stored in ACNUC9435 zone)

EMBL: CP000904.PE274

CP000904.PE274       Location/Qualifiers
FT   CDS_pept        387031..387669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5748"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46698"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX7"
FT                   /protein_id="ABY46698.1"
FT                   /translation="MAVEINKPTQANGSMDYEDMTKTIKHLLDAAWGTQWGSFTPEEPT
FT                   VTVDKPVEYPVIIHYLKLMQPGLIGKSIREIKPRQRYLAFNEDPKGTLPPATKVYGQVF
FT                   DAEIVFEIWEETNARVDKLTKEFRQTLATFTGFLKEKGLKELQFVKMETDLSKTNISNA
FT                   SKVRRLVYFAKFEELTEVPVDILRVIDVVEQKLQETTKTLRNKKIQLDE"
     atggcagtag aaatcaataa gccaacccaa gcaaatggtt ctatggacta tgaagacatg        60
     acaaagacaa ttaagcattt actagatgct gcttggggaa ctcagtgggg aagctttact       120
     ccggaagaac caactgtgac agttgacaag cctgtagaat atccagttat catacattac       180
     cttaagttaa tgcaaccagg actaattggt aaaagcatca gagaaattaa acctcgtcaa       240
     cgttaccttg cttttaatga agatcctaaa ggaactctac cacctgcaac taaggtttat       300
     ggtcaggtat ttgatgcaga aattgttttt gagatttggg aagaaaccaa tgcgcgagta       360
     gacaagctca caaaggagtt tcgtcaaacg cttgcaacat tcacgggatt ccttaaagag       420
     aaggggctta aagaacttca attcgtaaag atggaaacag acttatcaaa aacaaatata       480
     agtaatgcta gtaaggttcg tagacttgtt tattttgcta agtttgaaga attaacagaa       540
     gttcctgtag atatccttcg tgtgatagat gttgtagaac agaaacttca ggaaaccaca       600
     aaaacgttaa gaaacaaaaa aatccaactg gatgaatag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page