(data stored in ACNUC9435 zone)

EMBL: CP000904.PE275

CP000904.PE275       Location/Qualifiers
FT   CDS_pept        387716..389431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5749"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46699"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX8"
FT                   /protein_id="ABY46699.1"
FT                   /translation="MLYENLPGINVTLKDGGLIVPERGGSESILIIAPSLAKDAPEEPV
FT                   LIRSSTELVQAGFGDFYVAGEVNPIAAEWKAATDAGARMVYLVALKEISLERAAELEKN
FT                   AIDAYVAAGNQLVDAQAKFKDVLVGSTEAVRMRRKFIYFYDMLMSDLLDFTVDHVVLKG
FT                   VTLEDEATNLVGEFFTEVPNSEDFPYISGMVTSSYVIESHSINYPVEIKTGTSDTLVVK
FT                   VDGKDVTFTLPAKTYNGSSLTIADLVKDLKAVIDADATGIKVNVREDSGKIVLYFDAPA
FT                   SIQAGTTAAGLQLDKQVATWKKTSFGVIHRGSFAQTVADYCSMKTLMKSAAIGYIGVKS
FT                   PVDTKVSTIRKYVDELSKIDTEISPYLQVVGSEVGVIMPTTNSIHYVNGATHYAALLST
FT                   LRKESAPTNKPIKGVKAIRFDYSLRQLSKLTSKKIVTFRLKDSTQLVVTDGITTAPSIV
FT                   MAGKVRESDFARLSTLRITQLAIQVVREAVEPFIGEANEMPQYNAMNTAIKSALEKIRE
FT                   AGAIQGYKFSIENLGVYLDEVTVTLEIIPAFELRRVQVQVNLTPPEYMLQGLSK"
     atgctttatg aaaatcttcc tggcattaat gtcacattaa aagatggtgg cttaattgtc        60
     ccagaacgag gcggatcaga atcgatccta atcattgcgc catctcttgc gaaagatgct       120
     cctgaagaac cagtattaat tcgtagttca actgaacttg tacaagctgg attcggtgac       180
     ttctatgttg caggagaagt taacccaatt gctgcagaat ggaaagctgc tactgatgca       240
     ggagctagaa tggtttacct agtagccctt aaagaaatca gcttagagcg tgctgctgaa       300
     cttgagaaaa atgcaattga tgcttatgtg gctgcaggaa accaactagt agatgcccaa       360
     gctaaattca aagacgtttt agttggctct acagaagctg ttcgtatgcg tcgaaaattt       420
     atctatttct acgacatgct aatgagcgac cttcttgatt tcactgtgga tcacgtagtt       480
     cttaaagggg ttacacttga ggacgaagct actaacttag ttggtgagtt tttcactgaa       540
     gttccaaact ctgaagattt cccttacatt agtggaatgg ttacttcttc ttatgtaatc       600
     gagtctcact ctattaatta cccagtagaa atcaaaactg gtacaagcga tacgctagta       660
     gtaaaggttg atggcaaaga tgtaacgttt acgcttcctg ctaaaactta caatggtagt       720
     tcattaacaa tagctgacct agtaaaagac ttgaaggctg ttatcgatgc agatgcaact       780
     ggtatcaaag ttaatgtgag agaagacagt ggtaaaatcg tcctttactt cgatgctcct       840
     gcttctatcc aagctggtac aacagctgct ggtcttcaat tagataagca agtagcaaca       900
     tggaagaaaa caagctttgg tgtaattcac cgcggttcat tcgctcaaac agttgctgat       960
     tattgttcaa tgaagacttt aatgaaatca gccgcgatcg gatacattgg ggttaaatct      1020
     ccagtagata cgaaagtttc tacaatccgc aaatatgtgg acgaactatc taagattgat      1080
     acagaaatct ctccttatct tcaagtagtg gggtctgaag tgggagtaat catgccaaca      1140
     acaaactcaa tccactatgt aaatggtgcg actcactacg ctgcactact ttcgactctt      1200
     cgaaaagaaa gtgcacctac aaataaaccg ataaaaggtg ttaaagctat ccgctttgat      1260
     tactctcttc gccaactttc taaactgact agcaagaaaa tcgttacatt ccgtttgaaa      1320
     gattcaactc aactagttgt tacagacgga atcacaactg ctccatctat tgtaatggcc      1380
     ggaaaagtac gtgaaagtga ctttgctcgt ttatctacgc ttcgtatcac ccagcttgct      1440
     atccaagttg ttcgtgaagc agtagaacca tttattggtg aagcgaacga aatgccacaa      1500
     tataacgcaa tgaacactgc gatcaagtct gcattagaga aaatacgcga agcaggcgcg      1560
     attcaaggat ataaattctc aattgaaaac cttggagtat acttagatga ggtaactgta      1620
     actttagaaa tcatcccggc atttgaatta cgtcgtgtac aagttcaagt taacttaact      1680
     cctcctgagt atatgctaca aggccttagc aagtaa                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page