(data stored in ACNUC9435 zone)

EMBL: CP000904.PE277

CP000904.PE277       Location/Qualifiers
FT   CDS_pept        390836..391333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5752"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46701"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY0"
FT                   /protein_id="ABY46701.1"
FT                   /translation="MSSRYQKTYTSFAGTDIVAVVTPEGGKSVVLGQLQTISYSVYRPT
FT                   APVFALGQIAAKGVVRGARTVAGSLIFTVFDRHVLYEIMKDHNANGNSCPINKSDELPP
FT                   FDITINFMNEYGQSSKLAIYGINLISEGQTMSVEDMITENTMEFIALDIETMKPDVFDE
FT                   GW"
     atgagtagta gatatcagaa gacttatacg agttttgctg gtacagatat tgttgctgtt        60
     gtaactcctg aaggtggtaa atctgtagtg ctaggtcaat tacaaacaat ctcttattct       120
     gtgtatagac caacagctcc agtatttgct ttaggacaaa ttgcagctaa aggtgtagtc       180
     cgtggtgcaa gaactgtagc aggaagctta attttcacag tgtttgaccg ccatgtatta       240
     tacgaaatta tgaaagatca taatgcgaat ggaaacagtt gtcctattaa taaaagtgac       300
     gagctgccac catttgatat aacaattaat tttatgaatg aatatgggca atcttcaaaa       360
     ttggcgatat atggaattaa tcttatctca gaaggtcaaa caatgtcagt tgaagacatg       420
     attacagaaa acacaatgga attcattgca ctagatatcg aaacaatgaa accagatgtt       480
     tttgatgaag ggtggtaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page