(data stored in ACNUC9435 zone)

EMBL: CP000904.PE278

CP000904.PE278       Location/Qualifiers
FT   CDS_pept        391339..392055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5753"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY1"
FT                   /protein_id="ABY46702.1"
FT                   /translation="MSDGAYTPAGKPKRGYANYYSGTDIRIYFGDNWIDEIVEIEWTMQ
FT                   EQLAPIYGYASYTWDKVARGNRLVQGSFSINFKEAGYLQTVLNSLSSEMKDENEWFSLA
FT                   EFNGENGQSAHKNTKVEDLIGNFQALADDYENALWGTNSNSSKLIDSRKTDTFFYSTNE
FT                   NEKNKNLKEHGFNILLTYGNNPCAVRGAGSYKTVQTIVGVQLTGVSQRVDPSGNPISEV
FT                   YTFIAKDISGNVQKAY"
     atgagtgatg gggcttatac accagcaggt aaacctaaaa ggggttatgc gaattattac        60
     tcaggaacag atatccgaat ctacttcgga gataactgga tagatgaaat tgtagaaata       120
     gaatggacaa tgcaagaaca attagcgcca atctatggat atgcttctta tacctgggat       180
     aaggtagcta gaggaaatag gttggttcag ggttcctttt ctattaactt caaagaagct       240
     ggttatttac aaactgtact taatagttta agttctgaaa tgaaagatga aaatgagtgg       300
     tttagcctag cagaatttaa tggtgaaaat ggtcagagtg ctcataagaa tacaaaggtt       360
     gaagacctta taggtaattt tcaagcatta gcagatgatt acgaaaatgc actgtgggga       420
     acaaactcta actcttcaaa gttaatagat agccgtaaaa ctgacacatt cttttatagc       480
     acaaatgaaa atgaaaaaaa taagaatttg aaagaacatg gtttcaatat cttactaact       540
     tacggaaata acccctgtgc cgttagagga gcaggaagct acaagaccgt tcaaacaata       600
     gttggggtac aactaacagg tgtttcacaa agagttgatc cgtccgggaa tcctatttct       660
     gaagtatata cttttatagc aaaagatatc tcagggaatg tacaaaaagc gtactag          717
//

If you have problems or comments...

PBIL Back to PBIL home page