(data stored in ACNUC9435 zone)

EMBL: CP000904.PE279

CP000904.PE279       Location/Qualifiers
FT   CDS_pept        392135..392578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5754"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46703"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY2"
FT                   /protein_id="ABY46703.1"
FT                   /translation="MAKRFEKEEAFTENAQEETSVVKVGDKFDEDDVSKAEQEIFPGGP
FT                   TYNELEKWKSMYAGEVYLTEFDEENIFVWRPIKRKEYKDIAKIPNADNFYKEERICEKA
FT                   VLFPANYGFMQMTNGKAGIPTLLHELVLEKSGFAAKTGAMRLS"
     atggcaaaac gttttgaaaa agaagaagct tttacggaga atgctcaaga agaaacttcg        60
     gttgttaaag taggagacaa atttgatgaa gatgacgttt caaaagcgga acaagaaatc       120
     tttccaggtg gtccaactta taacgaactt gaaaaatgga agtcaatgta tgcaggagaa       180
     gtatacttga ctgaattcga tgaagaaaac atttttgtat ggcgaccaat taagcgtaaa       240
     gaatacaaag atattgctaa aattccaaat gcagataatt tctataaaga agagcgtatt       300
     tgtgaaaaag cagttctgtt ccctgctaac tatggattta tgcaaatgac aaatggtaaa       360
     gctggtatcc cgacactatt acacgaattg gtattagaga aatcagggtt tgcagcgaaa       420
     acaggcgcaa tgcgcttaag ctaa                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page