(data stored in ACNUC9435 zone)

EMBL: CP000904.PE28

CP000904.PE28        Location/Qualifiers
FT   CDS_pept        complement(50849..51721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5461"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: lwe:lwe1801 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5461"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46452"
FT                   /db_xref="GOA:A9VV20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV20"
FT                   /protein_id="ABY46452.1"
FT                   /translation="MEIKELNTFKMIVEEGTFSLAAKKLNYAQSTVTTHIKKLENELGF
FT                   LLFERGWDARLTEEGTLFAKEVDNLLMHWDYSVSQAQRISNEEKGRVRIGLTESVAKKL
FT                   MPSILNYLDNEKPYIHCDFVVGNTALLSQLLEQNKIDFAVCGNNKNSSNMNFTPLYNEQ
FT                   IEFIVNNPHHPILHKESIEVFDIVNYPILIGENSCYYYQSVNAFLSENNLSFKRIYNCS
FT                   ALHLIPQMVFGNAIGIIPKGTILNKGNISFKVKGFDPQMPIGLLISSKNRNYLSQTKQR
FT                   LMKLIESLL"
     atggaaataa aagagttaaa tacatttaag atgattgtcg aagaaggtac tttttcactg        60
     gcagcaaaaa aattaaacta tgctcaatca actgtaacaa cacatataaa aaagctggag       120
     aatgaacttg gcttccttct atttgaacga gggtgggatg cgcgattaac agaggaaggt       180
     actttatttg caaaggaggt agataactta ttaatgcatt gggattattc agtatctcaa       240
     gcacagcgca taagtaatga ggaaaaaggg agagtaagaa taggactaac agaatctgtt       300
     gcaaaaaagt taatgccatc tatattaaac tatttagaca atgagaaacc atatatacat       360
     tgtgattttg ttgtagggaa tacagcactt ttatcacaac tattagaaca aaataaaatt       420
     gattttgctg tttgcggaaa caacaaaaat agttccaata tgaacttcac tccactttac       480
     aatgaacaaa ttgaatttat tgtcaataac cctcaccatc caatattaca caaagagtca       540
     attgaagtat tcgatatcgt taattatcct attttaattg gagagaatag ttgttattat       600
     tatcaatctg tgaatgcctt tttatcagaa aataatttat cttttaaaag aatttacaat       660
     tgtagtgcat tacatcttat tccacaaatg gtttttggaa atgcaatagg tattattcct       720
     aagggaacta ttttaaacaa aggtaatata tcatttaagg ttaaaggatt tgatccccaa       780
     atgcctatag gattattaat ttcttctaaa aacagaaatt atttgagcca gacaaaacaa       840
     cgacttatga aattaattga atcgttattg tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page