(data stored in ACNUC9435 zone)

EMBL: CP000904.PE280

CP000904.PE280       Location/Qualifiers
FT   CDS_pept        392632..393201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5755"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46704"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY3"
FT                   /protein_id="ABY46704.1"
FT                   /translation="MLIDPNLLDDKVKELPIEFETYEEEVDFKEQLRIWHEKHGHIFMQ
FT                   EISDVLFFFRALSKEELKIAQEVYNDDYERTEYICKTCVIEPIIEDYSLDIFAGVPEIL
FT                   CLSILEESGYTKAQKVKIMIARWEKYMEETENQLPLIIKEAFQDIPLSEIESWTMAKTA
FT                   EYYVKAKWLLENIRGLKLLSEEEVQQ"
     atgctaatcg atcctaattt attagatgac aaggtaaaag aattacctat tgaatttgaa        60
     acatatgaag aagaggtaga ttttaaggaa caattgcgta tttggcatga gaaacatgga       120
     catatcttca tgcaagaaat aagcgatgta ctatttttct tccgtgcatt aagtaaagaa       180
     gaattgaaaa ttgcacagga agtatacaat gacgactatg aaagaactga gtatatatgt       240
     aaaacttgcg ttatagagcc aattattgaa gactactcgt tagatatttt tgcaggtgtt       300
     ccggaaattc tttgcctttc tatcttagag gagtcaggtt atacaaaggc tcaaaaagtt       360
     aaaatcatga tagctagatg ggaaaaatat atggaagaaa cagaaaatca acttccatta       420
     ataataaaag aagcatttca agatattcca ttaagcgaaa ttgaatcatg gacaatggct       480
     aaaacagcag agtattatgt caaagctaaa tggttattag aaaatatacg gggattaaaa       540
     ttattaagtg aagaagaagt tcaacaatag                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page