(data stored in ACNUC9435 zone)

EMBL: CP000904.PE281

CP000904.PE281       Location/Qualifiers
FT   CDS_pept        393225..397577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5756"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46705"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY4"
FT                   /protein_id="ABY46705.1"
FT                   /translation="MADKRYMGEEKEKNHLLSNIAKTGSLKGGGVMAYRNFSMIGKSDA
FT                   LGETAYVSRKLRGGFDGNIQEKMYKKLENYVRRNIKKKQMLKNHLAQNNIEFVNRYYKE
FT                   FHKRNMWGFNKFEYAATQSFRQNKILENLLKLSSIKNNGGDKILNALIQYHNQNKGIFN
FT                   SPADYINDFIKQLENGKYAPKVKFLDDTQRNVFQKQMLQTLEWYQDIKKVFEENKGTIL
FT                   SQAKAMETASTYEFIQDAINQTDVLMTRLKKTGFNYTTLKDAEKLDTATKRKYGLIIDD
FT                   IDEKGNEKSIDVTGELRKFLDNNKHNDDLNALLGKKGISFVFENMILDSNLYTHAKTGE
FT                   IIDNRHLKAGAVRAIDSFQKSIKVPFFINSPMDLKSWQAFYSSLSKEELQVVASEQFHR
FT                   FVSNLDEKGFDSVTKTNQGGYIRNPLNNSDHFYTGGNVFPYTESGVRDLINEGSYLASS
FT                   QFGTFSRMDKSYARSGYKKELTGRDASQLYEDTSVKELGKGTWKYINLSEGFISLREAA
FT                   VDKSLPTLMEFMIPTFGEDVVRIPAIEKLRRSFHQFALRVLDNEASFFTQDVVKKDARN
FT                   KRILSELDIKNMKGLDTLTEFQGYDNIHTIDARPREAKILLEDVMNNDKGKAEKEIVSD
FT                   FNINNLKNYGAIDNGWDLAINTKMNASNAASTLVEQELAVSKDRLVGRHTYRDALANVK
FT                   NSTQDIEDIGRIDELSDFLKEEFYTASKLGNIYGFLTKTGVEYEDSWRGKTLVSSILRT
FT                   YPRHDFLVANHGSALPGIGRRYVSRGLNKVYYSPIRNKMSDCLTSIIGESTDLLLSDQI
FT                   QKNEIKLLGKVYETLVKHYSDGIGSDEFVNDGMFNRFPILAETNPNSGQYKVAKHQIPL
FT                   LRQSGGFTENMDKEFDEITKLIHDNQDTYYWYDKKFSNADIQEKSGTGSKIIDANTFMV
FT                   REFDTPVKLTQKDNRDVIYWMEQYFKLGEKDKIGFTRDLVARKNNNTYGSMDAVVYTNR
FT                   SEDGHFGFKTNKGQSFNALIGNRIWKNPFQISDDGSSTSTKAFNLNNMVAVGKYSEMLT
FT                   HDIVPKMPFAGILDDKFLQERTTIESYKRDQVYDSDWGPWPQPYEGWINTMINTVVSQN
FT                   PIITGEEMKAIGAGRILSRLGNVAVPQVREGEREINQHFDRLSYVKYYDLYEKSSKLAQ
FT                   SKEGESVEEFFDDAAGRGRNNIGLKRYLTDKKKTLSWAKKMGYGDTEAVKSKIDEFSDG
FT                   LGDISSTKEANQASKYIPLAIKYRQKYEGTLYSMGDTEDSGSTSLMRALKPKGKKYVPQ
FT                   FFETTSSKEGQEILQYVSEDTKEISQDSWGLRVDKQEDIEDYFNTHYLPTENWNGWNAS
FT                   TNLDDIKIKVMQKKGVNPTTSGYWSKDQARVEKTGEKEIQIHPLSSLINIGRLRDVLLG
FT                   MGLSDVDVQLTTSYGEGPGGINTSIDIMKNVKNEILDGFNAGVHSSLF"
     atggccgata aacgttatat gggtgaagag aaagagaaaa atcatttgct tagtaatata        60
     gcaaaaacag gttctcttaa aggtggaggg gtaatggcat atcgtaattt ttcaatgata       120
     ggtaaatctg atgctcttgg tgaaactgct tatgttagta gaaaattacg cggtggtttt       180
     gatggtaata tacaggaaaa gatgtataaa aaattagaaa attatgtccg tagaaatatt       240
     aaaaaaaagc agatgcttaa gaatcatcta gctcaaaaca atatcgaatt cgttaaccgt       300
     tattataaag aattccacaa aagaaatatg tggggtttta acaagtttga atacgcagct       360
     actcaatcat tccgtcaaaa taaaatcctt gaaaaccttc taaaactatc ttctattaaa       420
     aataatggtg gggacaagat tctcaacgcc cttatccaat accacaatca gaataaaggt       480
     attttcaata gtcctgccga ttacattaat gactttataa agcaactcga aaatggaaaa       540
     tacgctccta aagttaaatt cctagacgat acgcaacgaa atgtatttca gaagcaaatg       600
     cttcaaactc ttgagtggta ccaggatatt aaaaaagtat ttgaagaaaa taaaggtaca       660
     atcttatctc aagctaaggc aatggaaacc gcgtctactt atgaatttat ccaagatgca       720
     attaatcaaa cagacgtatt aatgactcga ttaaagaaaa caggttttaa ttacactaca       780
     ttaaaagatg ctgaaaaatt agatacagct accaagcgta agtatgggtt aatcattgat       840
     gacattgatg aaaaaggaaa tgagaaatct attgatgtta ctggggagtt acgaaaattc       900
     ttagataaca ataaacacaa tgacgattta aatgcattgt taggtaaaaa gggaatatct       960
     ttcgtctttg aaaatatgat tcttgatagt aatttataca ctcatgctaa aacaggtgaa      1020
     ataattgata acagacattt aaaagctggt gctgttagag caatagattc ttttcagaaa      1080
     agtattaaag tcccattctt tattaatagc ccaatggatt taaaatcttg gcaagctttt      1140
     tattctagtc tatctaaaga agaattacag gtagtagctt cagagcaatt ccatagattc      1200
     gtaagcaact tagatgaaaa agggtttgat agtgtaacta aaacgaatca aggaggatat      1260
     attcgtaatc cattaaataa tagtgaccat ttttatactg gtggaaatgt ttttccttat      1320
     acagaatctg gcgtgcgaga tttaattaat gaaggatcgt atctagcgtc atcacaattc      1380
     ggtacattct cacgtatgga taagtcttat gctcgctctg gttataaaaa agagttaaca      1440
     ggtagggatg cctcgcaact atacgaggat acttctgtta aagaattagg aaaaggaaca      1500
     tggaagtata taaatctctc tgaggggttt atttctttaa gggaagcggc agttgataaa      1560
     agtctaccaa ccttaatgga atttatgatt cctacatttg gtgaagatgt agtacgtatc      1620
     cctgcaatcg aaaaacttcg acgttcattc catcaattcg ctttaagggt attagataat      1680
     gaggcatcct tctttacgca ggatgtcgtg aagaaggatg caagaaacaa gagaatttta      1740
     tctgaattag atataaagaa tatgaaaggt ttagatacat taaccgagtt tcagggttat      1800
     gataatatcc atactattga tgcaagacct cgtgaagcaa agatattact tgaagatgtt      1860
     atgaataacg ataaaggtaa agctgaaaaa gaaattgtat cagattttaa tatcaacaac      1920
     ctgaagaatt atggagcgat tgataatgga tgggatctag cgattaacac aaaaatgaat      1980
     gctagcaatg cggcatcaac cctagttgag caagaactag ctgtttcaaa agatagatta      2040
     gtaggaagac atacttacag agacgcttta gcaaacgtaa aaaattcaac tcaagatatt      2100
     gaagatattg gtcgaattga tgagttatca gattttctta aagaggaatt ttatactgct      2160
     tcaaagttag gtaatatcta tggtttctta acgaaaacag gagttgagta tgaagattcc      2220
     tggcgtggga aaacacttgt atcatcaata ttaaggactt atccacgtca tgatttttta      2280
     gttgcgaacc atggtagtgc cttaccaggg attggtcgtc gttatgtttc tcgtggcctt      2340
     aacaaagttt attattcacc aatccgaaat aagatgtctg attgtttgac tagtataata      2400
     ggtgaatcaa cagatttatt gcttagtgat caaatacaga agaatgaaat aaaacttctt      2460
     ggtaaagtat atgaaacact tgttaagcat tattcggacg gaataggttc tgatgagttt      2520
     gtaaacgacg gtatgtttaa ccgattccct atcttggcag aaactaatcc taatagtgga      2580
     cagtacaaag tagctaagca tcaaattccg ttattacgtc aatctggtgg gtttacagaa      2640
     aatatggata aagagtttga tgagattaca aagctgattc acgataatca agatacatat      2700
     tattggtatg acaagaagtt ctcaaatgcc gatattcaag aaaaaagtgg aacaggctct      2760
     aagattattg atgcaaatac gttcatggtt cgagagtttg acactccagt taaattaact      2820
     cagaaagata accgagatgt tatttattgg atggagcagt attttaaact cggtgaaaaa      2880
     gataaaattg gttttactag agaccttgtt gctcgaaaga ataataatac atacggctca      2940
     atggatgctg ttgtatatac gaatagaagt gaagatggac attttgggtt taagactaat      3000
     aaaggtcaat catttaatgc tcttattggt aatcgtattt ggaagaatcc atttcagatt      3060
     agcgatgatg gtagctccac ttctacaaag gcttttaatt taaacaacat ggtagctgtt      3120
     gggaaatatt ctgaaatgtt aacgcatgat attgttccta aaatgccttt cgccggaata      3180
     ttagacgata agttcttaca ggaacgtaca acgattgaaa gttataagag agaccaagta      3240
     tacgattcag attggggacc ttggccccag ccatacgagg gttggattaa tacgatgata      3300
     aatacggttg tttctcaaaa tccaatcatt actggtgagg aaatgaaagc tatcggtgca      3360
     ggaagaattc tttctcgatt aggtaatgtt gcggttcctc aagtgcgtga aggtgaacga      3420
     gaaattaatc agcactttga tcgcttaagt tacgttaagt attatgatct ttatgagaaa      3480
     tctagtaaac ttgctcaaag taaagaaggt gaaagtgtag aagagttttt tgacgatgca      3540
     gcaggaagag gacgaaataa cataggatta aaacgctact taacagataa gaagaaaaca      3600
     ttgtcctggg ctaaaaaaat gggttatggt gacaccgaag ccgttaaatc aaaaattgac      3660
     gaattctccg atggattagg agatatttcg tctacaaaag aagctaatca agcaagtaag      3720
     tacataccct tagctattaa gtatcgacaa aaatatgaag gtactcttta tagtatgggt      3780
     gatactgaag actctggtag cacatcgtta atgagagcct taaaacctaa agggaaaaaa      3840
     tatgtccctc aattctttga gacgactagc agtaaagaag gtcaagagat tcttcagtat      3900
     gtttctgagg acacaaaaga aatttcacag gatagttggg ggcttagagt agataaacaa      3960
     gaagatattg aagattactt taatactcat tatctaccaa ctgaaaattg gaatggatgg      4020
     aacgcaagta caaatctcga tgatataaaa attaaggtta tgcagaagaa gggggtaaac      4080
     ccaaccactt ctggttattg gagtaaggat caagctagag tggaaaaaac aggagaaaaa      4140
     gagatccaaa tacacccttt aagtagtttg atcaatatcg gtcgcttgcg tgatgtgtta      4200
     ttaggaatgg gactatcaga tgtagatgtc caattaacta cttcttatgg tgaaggacca      4260
     ggtggaatta atacttccat cgacatcatg aaaaatgtga aaaatgaaat tttagatggt      4320
     tttaatgcag gggtgcattc ctcattattc tag                                   4353
//

If you have problems or comments...

PBIL Back to PBIL home page