(data stored in ACNUC9435 zone)

EMBL: CP000904.PE282

CP000904.PE282       Location/Qualifiers
FT   CDS_pept        397638..403889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5757"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46706"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY5"
FT                   /protein_id="ABY46706.1"
FT                   /translation="MEDIKRVPIKNRVLRPINESADDLGEIRTENQTEHAAAEYRQSVL
FT                   AQTYNELTKDNRISTLGIWELARTPNNFNVNAQQALDPFMKLKGDDHVLFFDIEAIGTP
FT                   EHMRSNKGLDLFAMTELSFSGTNFNGKDFVNKKGAIVSMAVAPEKDVYARLKQQINKLK
FT                   QNPMMSVSQDVHCTLLDLTKYTDASKFKSATSNGKSYMSLLGHSRVPSIDTAFTRNTIE
FT                   EIERGLNNLFYKGTKLEDALSIFQGHIMSSNAKLGGYNIHHYDLPAILGIVKDTSTKKF
FT                   FNDAAKNSLDFFHGYSATVKNPYSLTGASLRQEHIYQALLAKRKIKAGKEAIDGNPPLF
FT                   LYHLAKDDIQANIDIAGFTHQKIKSFIKGAEESPTYDFSSSAIKKNTLELGQELFSYQS
FT                   SYFDKDKYKYNLVGKLGKDGKSIVPRWGNLNTSLPSNENFVIREFLKDVALTGTDKKGF
FT                   GLRLDSKDVKGKILLLMSETQEGLAQQIHSSFMPMDDAISRNLRDLKVKHDASFREYER
FT                   MFDNNGWEKMKEYYNYLEKAGSVEEDFDWRSYIIKNGGTEELAMKFPYMVARLEGERDV
FT                   WGTAISTLKASGLSDKQKSIALRQIKSKLDEKGDNKAQVTAKGNRFLNFNFDKEYNTIF
FT                   NAKETNSIKDSFRSYINDRRGDRIGNLEKSYKLARIDELQELIINNFKLSPDRKASNDV
FT                   KYLVNQMKKEVMSGNKTEIALNEMSNLVREKVENMGTDNFVREVTNQMTDSRVTAIKGL
FT                   MKNLPNVMRESIENARSFRSANEILNGNSPLKKFLKEQDNRIKKLFEKKFGTHGMNDLD
FT                   IISRTSGMAAKYEELVDKIMSAYSKYFNTQIRFMDGGNPLLILASKKSIMNLSEVRTYE
FT                   ELVRNPRVFTIELPSFDKDMKVKYGGNRKTSVIRSGIGAKGAYHSTSVTDALNMILDYS
FT                   KKAKELSEIAESIDSKNAFVQIRQGLRYRVERQVDPVSTDASRKFYFDDKGMFDIKSAM
FT                   SDEVRSSKWDITGYAESWYRANSNRLGFSISADIIAQNAIEKGITFFEAMGQRAKGYAI
FT                   AGELLNFAKGASGLKGSMVGINTRSAAKGFVATTNTDTRTYRALGNYYAHTVENPNEPI
FT                   NYRKVDQEVASRVLRNSGKDQSFRTKNSFISSPAFKALDDANEVRGITMQTGYMTNEEI
FT                   ALKLNDANTIMKYKSMIDTAQSKKQITPVEASQMKGSLDKCMISTSEGLAFMDYKLMKA
FT                   FDGMDEVRINMNAEKVMFNNYIEIAIEKEAEKQGLANGLWKEKGITFDKPLEIDINSMF
FT                   NEKNHLTLGKYEINNIKNEIVDERRFKKDDTVSIIGFNTDDINKRSLVLGRQRKTGHGF
FT                   KVVTEGGFHATMTPMLGDIMSDLFGVEGVEQVISYQVEKKGATDLPALIRGYDTQIRQQ
FT                   FSGSVANNKITTDYATEERALSSFYKDVEQMLGIKTTNKDGQYVVDSNFGLDGKQLDYK
FT                   GREKLSSKWMDKLGFNREVFADITMAHEAWDRQGGISRDKVTVKEIGMLDNSDIRTGLY
FT                   GPGESSIYANFMHGMVYRSQTKPEIKAQQKVFKKMVKIVSNYENDWEPKTGDVVIDYTS
FT                   DGTGLMADVNAQMKDGVLHISKDSFEERPRKFGHNQTFTVEDYGKTVINAGLMEFNLES
FT                   GVKGKKIQEHLLSTKGTAYLKLPEFAANQYIPLLDINSMKLPGNVNYVEKTEFLDTLKG
FT                   NYTSIVRKTEEYNDLFTIDKFSASDIATRRGVLETEINREVSHLVANLSNSTSKEGVVE
FT                   RISGNFSRDNLSVFFPHYGINEEKQRNAVMNDITRLHVSDKANNKLAGDVITASEAFFS
FT                   ENSAENLTLGNLYGAKAYEKIRESLKGTGVNNDWGTVKNGELRIGKSEHEKSILASTTS
FT                   STISSVNNTRMRTSAAFMMMAETKKEPFNETEGSSQNAEEVMDNRRAVGPEIFLNEAVP
FT                   IHHTMRNEMNESLSDIATVGKKAFSGSAISLTGDGPIGFGELWATNALMKGTPTPEGLQ
FT                   EMAPVAPKTLGPPTARITPNQNGEYINISVKASASKRMNHNNLAAMINNEIMTMSNVKM
FT                   NTSVNVNDNSKKIDSKWLESAIANAMNKGYAY"
     atggaagata ttaaaagagt gcctattaaa aacagggttt taagacccat taatgaatca        60
     gcagacgact taggtgaaat tagaacagaa aatcaaactg aacatgcagc agcagaatac       120
     agacaaagcg tattagctca aacatataat gaattaacaa aagataatcg tattagtaca       180
     ttaggtattt gggagttggc tcgtactccg aataatttta atgtaaatgc tcaacaagca       240
     ttagaccctt ttatgaaatt aaaaggtgat gaccatgtat tattctttga tatagaagca       300
     atcggaacac ctgaacatat gagaagtaat aaagggttag atctatttgc tatgactgag       360
     ttatctttta gtggaactaa ttttaatgga aaagactttg ttaataagaa aggagctatt       420
     gtttcaatgg cagtcgctcc tgaaaaagat gtgtatgctc gattaaaaca gcaaattaat       480
     aaattaaagc agaatccgat gatgtcagtt tcacaagacg tgcattgtac attactggat       540
     ctaactaagt atactgatgc aagtaaattt aagagtgcta caagtaatgg gaaatcctat       600
     atgtctctat tagggcattc tcgagttcct tctatagaca ctgcctttac aagaaataca       660
     atagaagaaa ttgaacgtgg tctaaacaac ttgttttata aaggtacaaa acttgaagat       720
     gcattatcta tcttccaagg ccacattatg tctagtaatg caaaattagg tggatacaat       780
     atccaccact acgatttacc agctattctt gggatagtaa aggacacaag tacaaaaaaa       840
     ttctttaacg atgcagcgaa aaattcatta gacttttttc atggatactc tgcaacagtt       900
     aaaaatccat attcattaac cggtgctagt ttacgacaag aacatattta tcaagctctt       960
     ttagcaaaaa gaaaaattaa agccggtaaa gaagcaattg acgggaatcc ccctttattt      1020
     ctatatcatt tagcaaaaga tgatattcaa gcaaatattg atattgccgg gtttactcat      1080
     caaaaaatta aatcatttat taaaggagca gaagagtctc ctacttatga tttttcttca      1140
     tcagcaataa agaaaaatac tctagaacta ggtcaggaat tattttctta tcaaagtagt      1200
     tacttcgaca aagataagta caaatacaat cttgtgggta aacttggtaa agacggaaaa      1260
     agcatagtac ctcgatgggg aaatttaaac acgtcactcc cttcaaatga aaacttcgta      1320
     attcgagaat tcctcaaaga tgttgcatta acaggtacag ataaaaaagg ttttggctta      1380
     aggcttgatt ctaaagatgt aaagggtaaa attcttttat taatgtccga aacgcaggag      1440
     ggattagcac agcaaattca tagttcattc atgccaatgg atgatgcaat ttctagaaat      1500
     ctacgtgact taaaagtaaa acatgacgct tccttccgtg aatatgaacg aatgtttgac      1560
     aataatggat gggaaaagat gaaggaatac tataactacc tagagaaagc gggtagtgta      1620
     gaagaagatt tcgactggag atcatacatt atcaaaaatg gcgggacaga agaattagct      1680
     atgaaattcc cttatatggt cgcacgatta gagggagaaa gagatgtctg gggaacagct      1740
     attagtactc taaaagcctc aggattaagc gacaagcaga agtcaattgc actgcgacaa      1800
     attaaaagca agctagatga gaaaggagat aataaagctc aagtaactgc taaggggaat      1860
     agatttttaa attttaattt tgataaagaa tacaatacaa tatttaatgc aaaagaaacg      1920
     aattcaatta aagattcttt ccgttcttat attaacgata gaagagggga tcgtatcggg      1980
     aatctggaaa agtcatataa gttagctcgt attgatgaat tgcaagaatt aatcataaat      2040
     aacttcaaac tttcaccaga tagaaaagcc tctaatgatg tgaaatatct tgtgaatcag      2100
     atgaagaagg aagttatgtc gggaaataaa actgaaatag ctttgaatga aatgtctaac      2160
     ctcgttcgtg aaaaggtaga aaacatgggt acagacaatt ttgttcgtga agtaaccaat      2220
     cagatgacag atagccgtgt aaccgcaatt aaaggtttga tgaagaacct accaaatgtt      2280
     atgcgtgaaa gtattgaaaa tgctcgttca ttcagaagtg ctaatgaaat attaaatggt      2340
     aatagcccat taaagaaatt tttaaaagag caggataacc gtattaagaa attgtttgag      2400
     aagaaatttg gtacacatgg aatgaatgat ctagacataa ttagtaggac aagtggtatg      2460
     gctgctaagt atgaagaact tgttgataag atcatgtcag cttacagcaa atacttcaac      2520
     actcaaattc gatttatgga tggtggtaat ccgctactta ttttagctag taagaagagt      2580
     atcatgaatt taagcgaagt aagaacatat gaagaattgg ttcgaaaccc tagagtattc      2640
     actattgagc ttccatcctt tgataaggat atgaaggtta aatacggcgg aaaccgaaaa      2700
     acttctgtta ttcgttcagg tattggtgca aaaggtgcct atcatagtac atcggtaaca      2760
     gatgctctta atatgattct tgattactcc aagaaagcta aagagctgtc tgagatagct      2820
     gaaagtatag atagcaagaa tgcatttgtt caaataagac aagggcttcg ttatcgtgtt      2880
     gaaaggcaag tagatccagt ttctactgat gcaagtcgga aattctactt cgatgataag      2940
     ggaatgtttg atatcaaatc agctatgagt gacgaagtcc gttcaagcaa atgggatatc      3000
     acaggatatg cagagtcatg gtatcgtgca aattctaacc gattaggatt tagtatttct      3060
     gccgacatta ttgctcaaaa tgcaattgaa aaaggaatca cattctttga agcgatggga      3120
     caaagagcaa aagggtacgc tattgccgga gaacttctca attttgcaaa aggtgcttct      3180
     ggattaaaag gaagtatggt tggtattaat acacgttctg ctgcaaaagg ttttgttgct      3240
     actacaaata cagatactcg tacttacagg gcattaggta actactatgc tcatacagta      3300
     gaaaatccaa atgaaccaat taactaccga aaagtagacc aagaagtcgc ttcaagagtg      3360
     ttacgtaact cgggtaaaga tcaatcgttc cgcacgaaaa atagctttat ttcatcacct      3420
     gcattcaaag ctcttgatga tgcaaatgag gttcgtggta ttacaatgca aaccggttat      3480
     atgacaaatg aagaaattgc attaaaactg aatgatgcta acactattat gaaatacaag      3540
     agtatgattg atacagctca atctaaaaaa caaatcactc ctgtagaagc aagtcaaatg      3600
     aaggggtctt tagacaaatg tatgatttct actagtgaag gtttggcgtt tatggattac      3660
     aagttaatga aagcttttga tggaatggac gaggttcgta ttaatatgaa cgctgaaaaa      3720
     gtaatgttta acaactatat tgaaatagct attgaaaaag aagctgaaaa acaaggtctt      3780
     gctaatggtt tatggaaaga gaaaggaatt acttttgata aaccattaga gattgatata      3840
     aattctatgt tcaatgagaa gaatcatctt actcttggaa aatatgaaat caacaatatc      3900
     aaaaatgaaa ttgttgatga acgccgtttt aagaaagatg atacggtatc tatcattgga      3960
     ttcaacacag atgacattaa taaaagatcg cttgtattag gtagacaacg taaaacagga      4020
     catggattta aagtagtaac tgagggtggt ttccatgcta ctatgactcc tatgcttggt      4080
     gatatcatga gtgatttatt cggcgtagaa ggggtagaac aggtgatttc ttatcaagtg      4140
     gaaaagaaag gtgctactga cttaccagca ttaattcgtg gttacgatac tcaaattcgt      4200
     caacaattca gtggttctgt ggcaaataac aaaatcacta ctgactatgc tactgaagaa      4260
     agagctttat cttcattcta taaggatgtt gaacaaatgc ttggtattaa aacgactaat      4320
     aaagatggtc agtatgtagt ggattctaac tttggtttag atggaaaaca gctagactat      4380
     aaaggccgcg agaagctttc gtctaagtgg atggataaat taggctttaa tcgtgaagta      4440
     tttgctgaca tcacaatggc ccatgaagct tgggatcgtc agggtggaat tagccgtgat      4500
     aaggtcacgg ttaaagagat tggtatgtta gacaattccg atattcgaac aggattatat      4560
     ggtccgggag aatcctctat atatgctaac tttatgcatg ggatggttta taggtctcaa      4620
     acaaagccag aaattaaagc tcaacaaaaa gtattcaaga aaatggttaa gattgttagt      4680
     aactatgaaa atgattggga acctaaaaca ggagatgtag ttattgatta cacgtctgat      4740
     ggtacggggt taatggctga tgtaaatgca cagatgaaag atggggtact tcatataagt      4800
     aaggattcat ttgaagagag gcctcgaaaa tttggtcaca accaaacttt tactgttgag      4860
     gattacggca aaactgttat caatgctgga ttgatggagt ttaatttaga gtctggtgtt      4920
     aaaggtaaga agattcaaga acacttactt agcacaaaag gaacagcata cttgaaactt      4980
     ccggaatttg cagcgaatca atacattcct cttcttgata tcaactcaat gaaactacct      5040
     ggtaatgtta attacgtcga gaaaacggaa tttcttgata cattaaaagg caactatact      5100
     tctattgtta gaaaaacaga agagtacaat gatttgttta caatagataa gttttccgca      5160
     agcgatatag cgacgcgacg tggagttcta gaaacggaaa ttaatagaga agtttctcat      5220
     cttgttgcaa atcttagtaa ttcaacttcg aaagagggtg tggttgagcg tatttctggg      5280
     aacttcagca gagataattt atcagtgttt tttcctcatt atggtataaa tgaggaaaaa      5340
     caaagaaatg ctgtgatgaa tgatatcact agactacatg tttctgataa ggcgaataac      5400
     aaattagcgg gtgatgtaat cactgcttcc gaagcgttct tctcagagaa tagcgctgag      5460
     aacctcactc ttggaaatct atatggtgct aaagcatatg aaaaaatccg tgaatcactt      5520
     aaaggtacgg gcgtaaataa tgactgggga acagttaaga atggtgaact ccggataggt      5580
     aagtctgaac acgaaaaatc aatcctagct agtactactt cttctacaat tagcagtgta      5640
     aacaatacac gtatgagaac gtctgcagcg tttatgatga tggcagaaac aaaaaaagaa      5700
     ccatttaatg agacagaagg ttcaagtcaa aacgcagaag aagtaatgga taatagaaga      5760
     gctgttgggc cagaaatttt cttaaatgaa gcagtgccaa ttcatcatac aatgcgtaat      5820
     gagatgaatg aatcactatc agatattgcg actgttggta agaaagcatt cagtggaagt      5880
     gctataagtt taactgggga tgggcctata ggatttggtg aattatgggc gacaaacgct      5940
     ctaatgaaag gtacaccgac accagagggc ctgcaagaaa tggcaccagt agcacctaaa      6000
     actttagggc ctcctacagc ccgtataaca cctaatcaaa atggtgagta cattaacatt      6060
     tctgtaaagg catcggctag taagagaatg aatcataata acctagcagc gatgataaac      6120
     aatgaaatca tgacaatgtc gaatgtcaaa atgaacacga gtgttaacgt aaatgacaat      6180
     tcgaaaaaaa ttgacagcaa gtggctagag agtgctattg caaatgcgat gaataagggt      6240
     tatgcatatt aa                                                          6252
//

If you have problems or comments...

PBIL Back to PBIL home page