(data stored in ACNUC9435 zone)

EMBL: CP000904.PE283

CP000904.PE283       Location/Qualifiers
FT   CDS_pept        403957..411324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5758"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5758"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46707"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY6"
FT                   /protein_id="ABY46707.1"
FT                   /translation="MKEKILITSLTRVRKNAPWRVGIYINEGYTFINVGDKGNIATSPR
FT                   FNIFLSEVEKKVSRYPVDVSFYSIEDNREMEVTMMRDQIIYIDCGYNSHRLLSSARFYY
FT                   EKHVLSNPLELAQQKPEENNGLFNVMEKHEESITSSDYIAVGRVEKVTDGDTIDVNLIK
FT                   LSDYLSKHFKVNQTVTIRYNGVDTPEKAQLGAEKYKDPKNAKFGKTYGVTMQDMYTIGE
FT                   EAYKYNETILGGSASQKPLVIIHFDRNKSGDPPKQDAGYGRYIADIYATNEKSADIVFD
FT                   KVKDGTKFVHVNKSLLVKKSAKFPQIPLGLFPFGYANTATVLNPLNWIIELGLKAYDTG
FT                   TGSPSKDPNSDPDIGSPEPYDENINEQEINIGGTTGPTHNALDFFGPYDDRLSVFTNGI
FT                   KTIDDLKRHSKVRIGDVILTIPPISIEVNKTANISKIKTLRTKSSVLVNRGQSLTTLSM
FT                   DLYFHDIESINGKKYPWKKEYAKGEEAKHFYVDGLRPLLAQFAKAPFLPIDNYYINDVL
FT                   GIRDVALMNIEVTTVPNFPESLTAKLTLVEFNSEAYLMDKSTLGDSINYPMLRWYYNQS
FT                   LAGRGDKYRFFKGLEGPIKSDIKFTLADETFLATRKHAIDYMKNADSPEQRKVELETKN
FT                   TDYKNRKEDASVVKEILDQYYRYKDFDIKKHTIIDYFSKPGLDKASTSIQGLIRDKYKI
FT                   KKEEAENAIVEAGELFSNIYDNKYKDVNTILMHKEIFLPYESRLFYKIRFDWNFLESFN
FT                   NRYDEDPSVVYDKKQYQGKEKDGLIILKKLKDAGSQKILENKFKEFYEKETFRIPANDT
FT                   AIDALKKIAEGAKKMEEEVAKYKGEFDEYMKVIEASERMIPMKEYPISGKVIPISINAR
FT                   FSNEFSMAHVLSSEAASLQYMGGGDPYIDLILEVDESGARDFNNLISTSDYYAKTYNQG
FT                   ITNGYIGIENDLAQLFGIRYVMFESISVNTVPSFPGRYQIMLQGIAFDKTQRQREELTA
FT                   LPGNSKQMDLETLKNNKTAFANDRMIEARLHKLEVYPDMELPTYSQINDVLPEIDAGAK
FT                   EYPNLTGGTYLDPDFYFSTGNTLRQLIESSYQGNHQVNMFDATGVAAYTSNMSTDKLFD
FT                   TTEEDWEKLKALQETEGVEPIGWVFKWGQEQEAAKSDTPNTSAGPVMADQGGTASVKNA
FT                   DVQKFLTEKKDDEFAYETFPTMEEWKTLFPDGGNDYSTLAKDPSGDEALIYQEIDSLVD
FT                   KYFKKYYSFPDFIEECRGDLKDADKSKKLVSYQPAEDLYYASFNANRNKLHDANIGMVS
FT                   DLIKKGTIKEPKKTDRMDSKDFHKTEVKITKERFMTLMKAFLDKTSQWKHFKGKIPTVS
FT                   KAGRVGIAQVDVSSGDMKVDEVKRLMYNWRYNLQTAVKQLAEHYEKLNKLDKDCENFEV
FT                   ICRPWDGMFALYEKPDAKIKFAKDIEDNSFASGVISRFNHYATKPFNTFSGYNKDVYKG
FT                   KANLSMDEYITIGNGNKDDYVDKLLELEYYDLSVLKENKLKVDSDKKNIKKVMKEHLEK
FT                   MDKDELFSTYQKHLKFLYELSKQDSKIEKTVDFFGKWSLPNLVTWGKAGKMVDKATDVI
FT                   AGSKKDKNGYEYSRKIFEKAAKLYESIIDVDKTATASTESTDTRLYNDVDPRVLYEEMF
FT                   YDLRYHDQRGRMLRAFPGFQMFIIHEGDYFGKYKFWDNMYGFNAIQSIDVHRSRKIAAD
FT                   TAVISMTNVYSNLTTRRTDVDYADREMKWWDNYIWNEIPQDLIDKKENEIHKNLFLETG
FT                   ARIHLRMGYGATASDLPIVFNGTISELELGDVIEIVAQGDGIELGNVVSGDPEDTNDGL
FT                   FQVTEPRDLICSLMSSKGSWAKDFMNGVVDERLFKDNPLGIMHFGQPFDSNGSIDSKPL
FT                   GNLVWFNDNYGEVAQNIYSSNGTPTFSQWLHPNGERNNIFEDFSWKRLWDNKFKIFNPG
FT                   DEDNVVLKLYNNTVWDIIQSITYSTPDYIAAVHPFELRSTLFFGKPYWRCAFEYGSRYE
FT                   FEAADKTWKRYLTSQPKRPYMQNKFYMSAYDIIENNIKASEDNIFTNVIVNYDGKQTPV
FT                   LYADADIRYDKQKTRVVEADIVAKFGDFYTSEVMATHFGHSTLRDSMKDMYKGNLLVLG
FT                   DPTAKPHDMMYINDEINDLQGNALIKSVTHHFSMETGFITSIEPDLLVVNDDQVILEMS
FT                   KWYMSFGQSVAATLAIRAAANKAGRNMTKWITKSNSIPAKVGKWVSTKGLRHTVRMANS
FT                   DGDMDKILKTLDDIISKEDGDVKALQQKLAKDFEEAAQKVTKEVGEEAGKAAGKAAGKT
FT                   AGKTAFIKNTSKQALLKSGAAFAKVLSNSDDIAKIGKGAVGIIRGAASFTPVGLIVNAS
FT                   IWIGTEMLFEHYRRFKENLQCVVAMPLTYRGKELTAGINNHAGMIYGDAPGRYDVMFNA
FT                   KFGDDNGEDFFGSSLIKLANFFTGSGGEDGVYAKTEKARQLNELSKKQQQ"
     gtgaaagaaa aaatattaat tacctctcta acaagagtta gaaaaaatgc gccttggcgt        60
     gttggtatat acataaacga aggctacaca tttattaatg taggtgataa agggaacata       120
     gcaactagtc caagattcaa catatttctt tcggaggtag aaaagaaagt atctcgttat       180
     ccagtagatg ttagtttcta ttcgattgag gacaatagag aaatggaagt aacaatgatg       240
     cgtgaccaaa tcatttacat tgattgtggt tataattcac acagactatt atcaagtgct       300
     cgtttctact atgaaaaaca cgtactttct aatccattag aattagcaca gcaaaagccg       360
     gaagaaaaca atgggttatt taatgtgatg gaaaaacacg aagaatcaat tacttcttca       420
     gactacattg cggttggaag agtagagaaa gttacagatg gtgatacaat tgatgtgaat       480
     ctaataaagc tatctgacta tttatctaaa cattttaaag taaatcaaac agtcacaatt       540
     cgatataacg gtgtagatac accagaaaaa gctcaattag gggcagagaa atacaaagac       600
     cctaagaacg ctaagtttgg aaaaacatat ggtgttacaa tgcaagacat gtacacaatc       660
     ggagaagaag cgtataaata caatgagaca atcttaggag gaagtgcatc tcaaaaacca       720
     cttgtgatta ttcattttga ccgcaataaa agtggagatc cacctaaaca agacgctggt       780
     tatggtcgct acatagcaga catatatgca acgaatgaaa aaagtgctga tattgtattt       840
     gataaggtta aagatggaac gaaatttgta catgtaaata agtctctact agtaaaaaaa       900
     tcagcgaagt tccctcaaat tcctcttggt ctattcccat ttgggtatgc aaatactgca       960
     actgttctta atccgttgaa ttggattatt gagttagggt taaaagcata cgacactggt      1020
     actggttctc catcaaagga cccaaatagt gatcctgata tcggtagtcc tgaaccgtat      1080
     gatgaaaata ttaatgagca agagattaat ataggaggaa caacaggacc aactcataac      1140
     gccttagatt tctttgggcc gtatgatgac aggttatctg ttttcacaaa tggcatcaaa      1200
     acaatagatg acttaaaaag acattcaaag gttagaattg gggacgtgat ccttacaatc      1260
     ccacctatct ctattgaggt aaacaaaacc gcgaatatct ccaaaataaa aacacttcgt      1320
     acaaaatcct ctgtattagt taaccgtggt caatcactta ctactttaag catggatctt      1380
     tatttccacg atatcgaatc aattaatggt aagaaatatc cttggaagaa agaatacgca      1440
     aaaggggaag aagctaaaca tttctacgtg gatggactta gaccattact tgcacaattt      1500
     gctaaagcac cattccttcc aattgataac tactacatta atgacgtatt aggtatccgc      1560
     gatgtagctt taatgaatat cgaagtaaca acggttccta atttcccaga atctttaact      1620
     gctaaattaa cgcttgttga atttaattca gaggcatact tgatggacaa aagtacactg      1680
     ggcgattcta tcaactaccc aatgctaaga tggtactaca atcaatctct agcgggtcgt      1740
     ggggataaat atcgtttctt taaaggattg gaaggcccaa ttaaaagtga catcaaattc      1800
     actcttgctg acgaaacgtt cctggctaca cgaaagcacg ctattgatta catgaagaat      1860
     gcagattctc cagaacaaag aaaagtcgag ttagagacaa agaatacgga ttacaaaaat      1920
     agaaaagaag atgcatctgt tgttaaagaa atcttggatc agtattatcg ttataaagat      1980
     tttgatatca aaaaacacac aatcattgac tactttagta agccaggact agataaagca      2040
     tctacaagta ttcaaggatt aatcagagac aagtacaaaa tcaaaaaaga ggaagcagaa      2100
     aatgctattg tggaggcagg cgaactattt tctaatatat atgataataa atataaggac      2160
     gtaaacacta tcttaatgca taaggaaatc tttctccctt atgagtctcg tttattctac      2220
     aaaatccggt ttgattggaa ctttttagag tcatttaata atcgttatga tgaagaccct      2280
     tctgtggttt atgataaaaa acaatatcag ggaaaagaaa aagatggtct tattatttta      2340
     aagaaattaa aagatgcagg tagccaaaaa atacttgaaa ataaattcaa ggagttttat      2400
     gagaaagaaa cattccgtat tccggctaac gatactgcaa tcgacgcact taaaaaaatt      2460
     gcagaaggcg caaagaaaat ggaagaagaa gtagctaaat ataaaggcga atttgatgaa      2520
     tatatgaaag tcattgaagc tagtgagcgc atgattccaa tgaaagagta ccctatctct      2580
     gggaaggtta tcccaatctc tatcaatgct cgtttctcaa acgagtttag catggcgcat      2640
     gttctatcta gtgaagctgc atccctccaa tacatgggtg gtggagatcc ttatattgac      2700
     ttaatcttag aagtggatga aagtggcgca agagatttca ataatcttat ttcaacttct      2760
     gattactacg ctaagacata caatcaaggt atcacaaatg gatatatcgg tattgagaat      2820
     gaccttgctc aattatttgg tattcgatat gtaatgtttg aaagtatctc tgtaaacaca      2880
     gttcctagct tccctggaag atatcaaatc atgcttcaag gtattgcgtt tgataaaaca      2940
     cagcgtcaac gtgaagaact tacagcatta cctggaaaca gtaagcagat ggatcttgaa      3000
     acactgaaga acaataaaac agcatttgca aacgaccgta tgattgaagc aagacttcat      3060
     aaattagaag tttatccaga tatggagctt ccaacttact ctcaaattaa cgatgtatta      3120
     ccagagatag acgcaggtgc aaaagagtat ccaaacttaa caggtggaac atatctagac      3180
     cctgactttt atttctctac aggtaacaca ttaagacagt tgattgaatc aagctaccag      3240
     ggcaaccatc aagtaaacat gtttgatgct acaggtgtag ctgcttatac aagcaatatg      3300
     tcaacagaca agctttttga tacaactgag gaagactggg aaaaacttaa ggcactgcaa      3360
     gaaacagaag gtgtagaacc tattggatgg gtgttcaaat ggggccaaga gcaagaagct      3420
     gctaaatctg atactcctaa tacatcagca ggacctgtta tggctgatca aggtggtact      3480
     gcatcagtaa agaatgcaga cgtccaaaag tttttaacag agaaaaaaga tgatgaattt      3540
     gcttacgaaa ccttcccaac tatggaagaa tggaaaacac ttttccctga tggcgggaac      3600
     gactatagta ctttggctaa agaccccagc ggtgatgaag cactcattta tcaagagatt      3660
     gatagcttag ttgataagta ttttaagaag tattactcat tccctgactt cattgaagag      3720
     tgtcgtggag atttaaaaga tgcggataaa tctaaaaaac tagtatctta tcagcctgca      3780
     gaagatcttt attatgcaag ttttaacgca aatcgtaaca agctacatga tgctaacata      3840
     ggcatggtta gtgatctaat caaaaaagga accattaaag agcctaaaaa aacggatcgt      3900
     atggattcga aagacttcca caaaacagaa gtgaaaatca caaaagaacg attcatgaca      3960
     cttatgaaag cattccttga taaaacaagt caatggaagc atttcaaagg gaagatacct      4020
     actgtaagta aagctgggcg tgtaggaata gcgcaagtag atgtttcttc aggcgacatg      4080
     aaggttgatg aagtgaaacg cttaatgtat aactggagat acaatttaca aacagcagtc      4140
     aagcaacttg cggaacacta cgagaagtta aacaagttag acaaagattg tgagaacttt      4200
     gaagttattt gtcgtccttg ggatggaatg tttgctctat atgaaaaacc agatgcgaaa      4260
     attaaatttg ctaaagacat tgaagataac agttttgcaa gtggtgttat tagccgattc      4320
     aaccattacg cgactaagcc atttaatacg tttagcgggt acaataaaga tgtctataaa      4380
     ggaaaagcga atttaagcat ggacgagtac attacaatcg gtaatggtaa taaggatgac      4440
     tacgttgata aacttcttga gcttgaatac tatgatttat cagtattaaa agaaaataaa      4500
     ttaaaagttg actctgataa gaaaaacatc aagaaggtta tgaaagaaca tcttgaaaag      4560
     atggacaagg acgaactgtt cagtacttat cagaagcatc taaagttctt atatgagcta      4620
     agtaaacagg atagcaagat agaaaaaact gtggactttt tcgggaaatg gagtctacca      4680
     aatcttgtaa cctggggtaa agctggaaaa atggttgata aagcaacaga tgtaatagcg      4740
     ggaagtaaaa aagataagaa tggatacgag tattcacgaa aaatctttga aaaagccgct      4800
     aagctttatg agtcaattat tgatgttgat aagacagcta ctgcttcaac agaatctacg      4860
     gacactcgtt tatataatga tgttgatcca cgcgtattgt atgaagagat gttctacgac      4920
     ttaagatacc atgaccaacg tggaagaatg cttcgtgcat tcccaggatt ccaaatgttc      4980
     attattcatg aaggtgatta tttcgggaaa tacaagtttt gggacaatat gtatggattc      5040
     aatgctatcc aaagcataga cgttcatcgt tctcgtaaga tagctgcaga tacagcagta      5100
     atctctatga ctaacgttta ctcgaactta acaactcgtc gtactgatgt tgactatgca      5160
     gaccgtgaga tgaaatggtg ggacaactac atctggaatg agattcctca agatctaatt      5220
     gacaaaaagg aaaacgaaat tcacaagaac ctcttcctgg aaacaggagc gcgtatccat      5280
     ttaagaatgg gatatggggc aacagctagt gatttaccaa ttgtattcaa tggtacgatt      5340
     tcagaattgg agcttggtga tgtaattgaa attgttgctc aaggtgatgg aattgaatta      5400
     ggaaacgtag tgtctggtga ccctgaggat actaatgatg gtttattcca agtaaccgaa      5460
     ccacgagatt tgatttgtag tcttatgagt tcgaaaggaa gttgggctaa agatttcatg      5520
     aacggtgtag ttgatgaacg actgtttaaa gacaaccctc taggaatcat gcattttggt      5580
     caaccgttcg actctaacgg ttccatcgat tcaaaaccat tgggtaacct agtatggttt      5640
     aacgataact atggagaagt tgctcaaaac atttattcct caaacggtac acctacattc      5700
     tctcaatggt tacatccaaa cggagaacga aataatatct ttgaagattt tagctggaag      5760
     cgtctatggg ataataagtt taaaatcttc aacccaggtg atgaagataa cgtagttctt      5820
     aagctttata acaatacggt ttgggatata atccaaagta ttacgtattc tactccggat      5880
     tatatcgctg ctgttcatcc gttcgaatta cgctccacat tattctttgg gaaaccatac      5940
     tggcgttgtg cattcgaata cggttctcga tatgaatttg aggcggcaga taaaacatgg      6000
     aaaagatacc ttacatctca accaaaacga ccatatatgc aaaataaatt ctacatgtcg      6060
     gcttatgata ttatagaaaa taatattaag gccagtgagg ataatatctt tacaaacgtt      6120
     atcgttaact atgacggaaa acaaacgcct gtactttatg cagatgctga tattcgttat      6180
     gacaaacaga aaacacgagt agtagaagcg gatattgtag caaaatttgg tgacttctat      6240
     acttcagaag ttatggcgac acatttcgga cattctactc ttcgagatag tatgaaagat      6300
     atgtataaag gaaatctatt agtactagga gatcctactg ctaaacctca cgatatgatg      6360
     tatatcaatg atgaaattaa cgacctacaa ggaaatgcgt taattaagtc ggtaacacat      6420
     cacttcagta tggaaactgg atttatcact tctattgagc cggatctact ggttgtaaat      6480
     gatgaccaag tgattcttga aatgagtaag tggtatatga gttttggaca atccgttgcc      6540
     gctacacttg caatccgtgc tgcagcaaat aaagctggga gaaacatgac taagtggatt      6600
     acaaaatcta atagtatccc tgctaaagta gggaaatggg tttcaacaaa aggcttaagg      6660
     catacagtga ggatggcaaa tagtgatgga gatatggaca aaatccttaa aacccttgat      6720
     gatatcattt caaaagagga tggcgatgtt aaagctcttc aacagaaatt agcaaaagat      6780
     ttcgaagagg cagcccaaaa agtgaccaag gaagtagggg aagaagcagg taaagcagct      6840
     gggaaagcag caggaaaaac agcaggaaaa acagcattta ttaagaacac aagtaaacag      6900
     gcccttctaa aatcgggggc tgcatttgca aaagtcttat caaattctga cgatatagca      6960
     aagatcggta aaggtgcagt aggtattatt cgaggggcag cttctttcac tccagtcgga      7020
     ctcattgtta acgcatcaat atggattggt acggaaatgt tgtttgaaca ctatcgtcgt      7080
     tttaaagaaa atcttcaatg tgttgtggca atgccattaa cttatagagg aaaagaatta      7140
     acggcaggta ttaacaacca tgcaggtatg atttacggtg atgcaccagg tcgatatgat      7200
     gtaatgttca atgcgaaatt tggtgatgat aatggtgagg atttctttgg tagtagtcta      7260
     ataaaactag ctaacttctt tactggttca ggtggagaag acggtgtgta tgcaaaaact      7320
     gagaaagctc gccagctaaa tgaattatct aagaagcaac aacaataa                   7368
//

If you have problems or comments...

PBIL Back to PBIL home page