(data stored in ACNUC9435 zone)

EMBL: CP000904.PE284

CP000904.PE284       Location/Qualifiers
FT   CDS_pept        411420..413507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5759"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   Lytic transglycosylase catalytic; KEGG: noc:Noc_1884
FT                   peptidase C14, caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5759"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46708"
FT                   /db_xref="GOA:A9VUY7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY7"
FT                   /protein_id="ABY46708.1"
FT                   /translation="MTEKEKPKDKPKTNDKQTYNIETYVKKIKAAKEVYEERKKFLQSF
FT                   SLKKKKEKPKADGGEVAAASGGGSVNFNGELPTVAQYTGPDVYTDKLLNGGVYQNGLKG
FT                   KVAGTDQWNQHIKEQAAKAGVNPLMIKVIMATESGGDHVKTPNSSNCVGLMQTEKEITG
FT                   NLGLDFGKACNDPVYNIYVGCMILKSKHDYAGGVISRGKNPYSDYKSLGYELKQNGHGV
FT                   AWLYNGFSVPLDGKNKVYRGGYVYANQVTAMYKGFGRDAYTDTILTLDVLSGGGGGGGS
FT                   SSSAGGKGTGGKWEYGKTFASGAEVVKFLDTVDTTTINGIYVHHTWDPDHTKAKGVSLA
FT                   TLNDNMRRFHTQTNGWDDIAQHFTIGVDGQVILGRNITSVPCSAKNYNGTDANHPAMYE
FT                   MIGNFDKGKDVLQGKQLESAVAIAKYFSGRPNGVKFHREGLINGQEPKSCPGTGVDKNW
FT                   FMGLVNGGAKASAFSVQSAPLSDNEIEENFAAGCDLYQDPVREKAVEYTAKLPPTGEEL
FT                   AFARSFSAKISIPVAKLKESRIVAPEYTRSSYVEDFKMSSSYDMKKNYSPLSPNEFIHL
FT                   NGPQDNFYTSEARQAFRLLKDRLGYRTLRIARGFDPSDGESSHSIGISMDIYADSTEEA
FT                   VYIADTAWIIGFRSIAVGPNFVHVDIGPEAVWGYDKLPIYRGPGTLKAGAFRYGYKQAN
FT                   L"
     atgacagaaa aagaaaaacc aaaagacaag ccaaaaacga atgacaaaca aacgtacaac        60
     attgagacat atgtaaagaa aataaaagca gcgaaagaag tatatgagga acgaaagaaa       120
     ttcctacaga gtttctcact caaaaagaaa aaagaaaagc caaaagctga cggtggggaa       180
     gttgctgctg catcgggtgg tggcagcgta aactttaatg gagaattacc tacggttgct       240
     cagtatactg gaccagatgt ttacaccgac aaactcctaa acggaggagt gtaccaaaat       300
     ggacttaaag gtaaggtagc tggtactgat caatggaatc agcatattaa agaacaagca       360
     gcaaaagctg gtgtaaaccc tctcatgatt aaagtaatta tggcaacaga atctggtggg       420
     gaccacgtta aaacaccaaa ctcttctaac tgtgttggat taatgcaaac agaaaaagaa       480
     attactggta atctaggttt agattttggt aaagcatgca atgatccggt ctataatatc       540
     tatgttgggt gcatgattct taaatcaaaa catgattatg ctggaggcgt tatctctagg       600
     ggtaaaaatc catattcaga ttataaaagc ctagggtatg agttaaaaca aaacggtcat       660
     ggggttgcct ggttatataa cggtttcagt gtgcctcttg acggaaaaaa caaggtttat       720
     cgtggtggat atgtttatgc gaaccaagta actgcgatgt ataaaggttt tggaagagac       780
     gcatacacag atacaatttt aactttggac gttttatctg gtggaggcgg tggtggcgga       840
     agttcatcat ctgctggtgg taaaggaaca ggcggaaaat gggaatatgg aaaaacattt       900
     gcaagcggtg cagaagtggt taaattcttg gatactgtag atacaactac gattaatgga       960
     atctatgtcc accatacttg ggacccagac catacaaagg ctaaaggtgt gtcactagca      1020
     acactaaatg acaatatgag aagatttcat acacaaacaa atggctggga cgatatcgcg      1080
     cagcacttca ctattggtgt ggatgggcaa gtaatccttg gacgtaatat tacatctgtc      1140
     ccatgtagtg caaaaaacta caatggtaca gatgctaatc accccgccat gtatgaaatg      1200
     ataggaaact ttgataaagg taaagacgtt ttgcaaggta aacagttgga atcggctgtt      1260
     gctattgcta aatacttttc tggtagacca aatggcgtaa agtttcaccg tgaaggatta      1320
     attaacggtc aggaaccaaa aagttgtcca ggtacaggtg ttgataaaaa ttggtttatg      1380
     ggactagtta atggtggagc aaaagcaagt gcattttctg ttcaatcagc tcctttatca      1440
     gataatgaga ttgaagagaa ttttgcggct ggctgtgacc tttatcaaga tccagtaaga      1500
     gagaaagctg ttgaatacac agccaagcta ccaccaaccg gagaggaatt agcatttgct      1560
     agaagttttt cagccaagat aagtattcct gttgcaaaat taaaagagag tagaattgtt      1620
     gccccggaat acacaagatc aagctatgtg gaagacttta aaatgtcatc cagttatgat      1680
     atgaaaaaaa attattcccc attgtctcca aatgaattta ttcatctaaa tggacctcaa      1740
     gataattttt acacaagtga agcaagacaa gctttccgtc ttcttaaaga tcgacttgga      1800
     tacagaactt taagaatagc tagagggttt gacccttccg atggagagtc atctcattct      1860
     attggtatat ctatggacat atatgctgat tccacggaag aagcagttta catagctgat      1920
     actgcatgga taataggatt tcgttcaatt gcggttgggc ctaattttgt tcatgttgat      1980
     atcggaccag aagcagtttg gggatatgat aagctaccaa tctatagagg accaggtaca      2040
     ttaaaggcag gtgcattccg ttatggctac aaacaagcaa acctttaa                   2088
//

If you have problems or comments...

PBIL Back to PBIL home page